Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1QGF8

Protein Details
Accession N1QGF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-62EEAIKRLKNKRIPWKKDVFQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20, mito 5
Family & Domain DBs
Amino Acid Sequences QRVEYLIDLTKPFAAATAVIGTTKGPTIHLVLAYYNKLFDILEEAIKRLKNKRIPWKKDVFQACEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.09
4 0.09
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.09
11 0.07
12 0.07
13 0.08
14 0.09
15 0.1
16 0.1
17 0.1
18 0.1
19 0.11
20 0.11
21 0.1
22 0.08
23 0.07
24 0.07
25 0.07
26 0.06
27 0.09
28 0.09
29 0.12
30 0.13
31 0.14
32 0.17
33 0.19
34 0.22
35 0.24
36 0.32
37 0.37
38 0.47
39 0.57
40 0.66
41 0.72
42 0.78
43 0.82
44 0.79
45 0.8
46 0.79
47 0.74