Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3BTS4

Protein Details
Accession M3BTS4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-53ETALRRPKPRSTRSRRGYQDHydrophilic
NLS Segment(s)
PositionSequence
39-48RPKPRSTRSR
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLPHIQRDRSDLHRYMRNAHAIGHPEWNDTCSAETALRRPKPRSTRSRRGYQDGIVAPRPPTVRSAIRRTKSIASVKAKTVQTRLGKTELWTTCSATVQAYEGSFGQHRSHWRKNRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.54
4 0.52
5 0.45
6 0.42
7 0.4
8 0.37
9 0.36
10 0.37
11 0.32
12 0.29
13 0.28
14 0.27
15 0.23
16 0.19
17 0.18
18 0.12
19 0.13
20 0.12
21 0.14
22 0.19
23 0.27
24 0.32
25 0.36
26 0.39
27 0.47
28 0.54
29 0.63
30 0.68
31 0.69
32 0.74
33 0.76
34 0.82
35 0.77
36 0.74
37 0.68
38 0.58
39 0.54
40 0.45
41 0.42
42 0.33
43 0.29
44 0.23
45 0.23
46 0.22
47 0.16
48 0.15
49 0.16
50 0.22
51 0.26
52 0.35
53 0.41
54 0.43
55 0.44
56 0.46
57 0.45
58 0.45
59 0.45
60 0.45
61 0.43
62 0.43
63 0.44
64 0.48
65 0.47
66 0.42
67 0.39
68 0.39
69 0.38
70 0.39
71 0.4
72 0.36
73 0.35
74 0.34
75 0.4
76 0.34
77 0.32
78 0.3
79 0.29
80 0.27
81 0.27
82 0.26
83 0.17
84 0.16
85 0.14
86 0.14
87 0.12
88 0.12
89 0.11
90 0.13
91 0.14
92 0.16
93 0.16
94 0.19
95 0.29
96 0.37
97 0.47