Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AXJ8

Protein Details
Accession M3AXJ8   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
108-152ADGGERRRRRREEKMKTKIKMKIKEKEKNKNKKVKVKKACDDSPSBasic
NLS Segment(s)
PositionSequence
112-145ERRRRRREEKMKTKIKMKIKEKEKNKNKKVKVKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSSLFSCWGALSHCILPQDMHNHHDSINESSALLYNHHHYNNNNKKKRSSSSSVPLPHFSSDEPEKNHPPYPLPTRPTQKKEGWWCIEVQQKERGEEVLENDDDDDDADGGERRRRRREEKMKTKIKMKIKEKEKNKNKKVKVKKACDDSPSPLQLLHVPSSSPVLWPGGRSLELGEISSMEVKYLLGIAEQQEWKGERTRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.22
5 0.28
6 0.27
7 0.28
8 0.29
9 0.29
10 0.28
11 0.31
12 0.29
13 0.25
14 0.25
15 0.22
16 0.19
17 0.19
18 0.2
19 0.18
20 0.17
21 0.14
22 0.15
23 0.2
24 0.22
25 0.25
26 0.26
27 0.36
28 0.46
29 0.56
30 0.6
31 0.6
32 0.64
33 0.68
34 0.73
35 0.7
36 0.66
37 0.63
38 0.64
39 0.68
40 0.68
41 0.64
42 0.59
43 0.52
44 0.46
45 0.39
46 0.3
47 0.27
48 0.26
49 0.28
50 0.29
51 0.33
52 0.36
53 0.38
54 0.41
55 0.36
56 0.34
57 0.35
58 0.39
59 0.41
60 0.4
61 0.43
62 0.5
63 0.58
64 0.6
65 0.61
66 0.56
67 0.57
68 0.63
69 0.65
70 0.59
71 0.51
72 0.47
73 0.45
74 0.47
75 0.41
76 0.34
77 0.32
78 0.3
79 0.3
80 0.29
81 0.24
82 0.19
83 0.18
84 0.18
85 0.14
86 0.12
87 0.11
88 0.11
89 0.1
90 0.09
91 0.08
92 0.07
93 0.03
94 0.03
95 0.03
96 0.05
97 0.06
98 0.11
99 0.15
100 0.2
101 0.29
102 0.36
103 0.43
104 0.53
105 0.63
106 0.71
107 0.77
108 0.83
109 0.84
110 0.82
111 0.82
112 0.79
113 0.76
114 0.75
115 0.72
116 0.71
117 0.72
118 0.76
119 0.78
120 0.82
121 0.83
122 0.85
123 0.86
124 0.87
125 0.86
126 0.88
127 0.89
128 0.89
129 0.89
130 0.88
131 0.87
132 0.85
133 0.81
134 0.76
135 0.69
136 0.64
137 0.6
138 0.52
139 0.44
140 0.35
141 0.3
142 0.29
143 0.27
144 0.23
145 0.17
146 0.15
147 0.16
148 0.19
149 0.18
150 0.15
151 0.13
152 0.14
153 0.14
154 0.15
155 0.16
156 0.16
157 0.16
158 0.16
159 0.16
160 0.16
161 0.16
162 0.16
163 0.13
164 0.11
165 0.11
166 0.14
167 0.13
168 0.09
169 0.09
170 0.08
171 0.08
172 0.09
173 0.08
174 0.05
175 0.07
176 0.09
177 0.15
178 0.17
179 0.17
180 0.2
181 0.22
182 0.24
183 0.29