Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3CKK2

Protein Details
Accession M3CKK2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-103EFHVYKASRRREYERQRLMEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSENIPESIPTSISSRSHRPAKKQRAIGSGPSNLQSSQVEALFANPDREIIIPSSASSKPKTLAAPPEIVANVQGSSAGAGSGEFHVYKASRRREYERQRLME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.37
4 0.46
5 0.5
6 0.58
7 0.65
8 0.73
9 0.76
10 0.77
11 0.76
12 0.74
13 0.72
14 0.69
15 0.63
16 0.56
17 0.48
18 0.42
19 0.37
20 0.29
21 0.27
22 0.2
23 0.16
24 0.14
25 0.12
26 0.11
27 0.1
28 0.1
29 0.11
30 0.11
31 0.1
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.11
42 0.12
43 0.14
44 0.14
45 0.14
46 0.15
47 0.17
48 0.19
49 0.19
50 0.24
51 0.24
52 0.25
53 0.24
54 0.25
55 0.22
56 0.21
57 0.18
58 0.12
59 0.1
60 0.07
61 0.07
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.03
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.1
74 0.11
75 0.18
76 0.26
77 0.35
78 0.41
79 0.47
80 0.56
81 0.64
82 0.74
83 0.79