Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QE73

Protein Details
Accession N1QE73    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MEKTKMKKTKTKTKVTKPKKGEGQNNKTSIHydrophilic
NLS Segment(s)
PositionSequence
5-21KMKKTKTKTKVTKPKKG
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MEKTKMKKTKTKTKVTKPKKGEGQNNKTSIWIMRSQIMGTGGYNPRDHAPPPSTRRKKAELTAVPACCATSTLAAMFHLLGGSASNSASISRFQPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.92
4 0.88
5 0.87
6 0.86
7 0.85
8 0.84
9 0.84
10 0.83
11 0.81
12 0.77
13 0.67
14 0.58
15 0.5
16 0.41
17 0.33
18 0.27
19 0.2
20 0.19
21 0.19
22 0.19
23 0.19
24 0.18
25 0.15
26 0.11
27 0.15
28 0.15
29 0.16
30 0.16
31 0.16
32 0.16
33 0.17
34 0.17
35 0.17
36 0.18
37 0.24
38 0.3
39 0.41
40 0.46
41 0.51
42 0.56
43 0.57
44 0.58
45 0.56
46 0.59
47 0.53
48 0.53
49 0.54
50 0.49
51 0.44
52 0.39
53 0.34
54 0.24
55 0.2
56 0.14
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09
63 0.08
64 0.07
65 0.06
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.09
76 0.1