Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3D2Z5

Protein Details
Accession M3D2Z5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-50IRRGRWFDGKRYRKKKQWSSSRVPSDYHydrophilic
NLS Segment(s)
PositionSequence
32-39GKRYRKKK
Subcellular Location(s) nucl 14, cyto_nucl 12, mito 6, cyto 6
Family & Domain DBs
Amino Acid Sequences MCSRLKICKGSGSGSSAVVDEDGIRRGRWFDGKRYRKKKQWSSSRVPSDYIPTTIRDEQPQELLQSVVAPSLPLLPYLPHSRALRAFRRFVSTPSLYGLYVVCGSNDSIIRCHSSPWPTVFSCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.22
4 0.19
5 0.15
6 0.12
7 0.09
8 0.09
9 0.11
10 0.12
11 0.12
12 0.13
13 0.14
14 0.17
15 0.25
16 0.28
17 0.35
18 0.45
19 0.55
20 0.65
21 0.74
22 0.8
23 0.79
24 0.87
25 0.87
26 0.86
27 0.87
28 0.85
29 0.85
30 0.85
31 0.85
32 0.76
33 0.67
34 0.57
35 0.51
36 0.43
37 0.36
38 0.27
39 0.2
40 0.23
41 0.24
42 0.24
43 0.21
44 0.22
45 0.2
46 0.22
47 0.2
48 0.16
49 0.14
50 0.13
51 0.1
52 0.09
53 0.08
54 0.05
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.09
64 0.14
65 0.15
66 0.19
67 0.19
68 0.22
69 0.28
70 0.34
71 0.39
72 0.4
73 0.43
74 0.39
75 0.45
76 0.43
77 0.4
78 0.41
79 0.34
80 0.3
81 0.29
82 0.29
83 0.22
84 0.22
85 0.2
86 0.14
87 0.13
88 0.12
89 0.1
90 0.09
91 0.09
92 0.12
93 0.14
94 0.14
95 0.14
96 0.16
97 0.21
98 0.2
99 0.22
100 0.26
101 0.28
102 0.32
103 0.35
104 0.39