Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3CX35

Protein Details
Accession M3CX35    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-92IDLLKRSNRKRYQYKDTPRRRSVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 6
Family & Domain DBs
Amino Acid Sequences MKLTQSILLAAASFNLAIGAPIKENPSRAIVAKDVIRKAIDNNPYILDNLDQSVAAEGNATPVRLRSLIDLLKRSNRKRYQYKDTPRRRSVDKRYEYGDTPALQSVEDLSKRYEYGDTPALQSVEDLSKRYQYKDTPRRRSVDKRYEYGDTPALQSVEDLSKRYEYGDTPALRSVEDLSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.07
6 0.07
7 0.08
8 0.1
9 0.14
10 0.15
11 0.17
12 0.19
13 0.21
14 0.22
15 0.22
16 0.24
17 0.22
18 0.24
19 0.27
20 0.31
21 0.29
22 0.29
23 0.28
24 0.26
25 0.28
26 0.32
27 0.33
28 0.28
29 0.29
30 0.28
31 0.28
32 0.27
33 0.24
34 0.17
35 0.12
36 0.11
37 0.1
38 0.08
39 0.07
40 0.08
41 0.07
42 0.06
43 0.06
44 0.05
45 0.08
46 0.09
47 0.09
48 0.08
49 0.09
50 0.1
51 0.1
52 0.11
53 0.09
54 0.13
55 0.17
56 0.2
57 0.23
58 0.24
59 0.32
60 0.39
61 0.41
62 0.46
63 0.5
64 0.56
65 0.63
66 0.68
67 0.71
68 0.73
69 0.81
70 0.81
71 0.85
72 0.85
73 0.81
74 0.76
75 0.73
76 0.72
77 0.72
78 0.71
79 0.65
80 0.58
81 0.56
82 0.54
83 0.48
84 0.41
85 0.34
86 0.24
87 0.2
88 0.19
89 0.16
90 0.13
91 0.12
92 0.1
93 0.11
94 0.11
95 0.11
96 0.11
97 0.12
98 0.12
99 0.13
100 0.13
101 0.11
102 0.14
103 0.17
104 0.17
105 0.17
106 0.18
107 0.17
108 0.16
109 0.15
110 0.12
111 0.11
112 0.11
113 0.12
114 0.12
115 0.19
116 0.2
117 0.23
118 0.26
119 0.3
120 0.41
121 0.5
122 0.6
123 0.63
124 0.67
125 0.68
126 0.7
127 0.72
128 0.71
129 0.71
130 0.65
131 0.58
132 0.56
133 0.54
134 0.48
135 0.41
136 0.34
137 0.24
138 0.2
139 0.19
140 0.16
141 0.13
142 0.12
143 0.1
144 0.11
145 0.11
146 0.11
147 0.11
148 0.12
149 0.12
150 0.13
151 0.13
152 0.11
153 0.14
154 0.21
155 0.22
156 0.24
157 0.28
158 0.27
159 0.26
160 0.26
161 0.25