Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3C5N4

Protein Details
Accession M3C5N4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26APAGGKAKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-20GKAKKKWSKGKVKDK
Subcellular Location(s) cyto 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAGGKAKKKWSKGKVKDKANHAVIFDKATTDKLNKDVQSYRLITVAVLVDRLKINGSLARKALKDLEERGVIKQVVGHSACKIYTREITGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.87
3 0.86
4 0.89
5 0.87
6 0.84
7 0.83
8 0.78
9 0.69
10 0.59
11 0.52
12 0.43
13 0.37
14 0.3
15 0.21
16 0.16
17 0.15
18 0.16
19 0.15
20 0.16
21 0.17
22 0.23
23 0.22
24 0.25
25 0.27
26 0.27
27 0.31
28 0.31
29 0.27
30 0.23
31 0.22
32 0.18
33 0.15
34 0.13
35 0.08
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.07
44 0.1
45 0.13
46 0.14
47 0.16
48 0.19
49 0.19
50 0.2
51 0.22
52 0.22
53 0.24
54 0.24
55 0.27
56 0.29
57 0.3
58 0.3
59 0.31
60 0.28
61 0.24
62 0.23
63 0.2
64 0.21
65 0.22
66 0.22
67 0.19
68 0.21
69 0.22
70 0.23
71 0.23
72 0.22
73 0.25
74 0.28