Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3CW35

Protein Details
Accession M3CW35    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MYKPRSKTKKTKSKLTLKKPTTKKRKKTPTSLSEDEHydrophilic
NLS Segment(s)
PositionSequence
3-27KPRSKTKKTKSKLTLKKPTTKKRKK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MYKPRSKTKKTKSKLTLKKPTTKKRKKTPTSLSEDESSDNPDNPSAQTDPPSTDQDNSDTGSQTDGNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.85
5 0.87
6 0.87
7 0.88
8 0.88
9 0.88
10 0.87
11 0.87
12 0.91
13 0.89
14 0.89
15 0.88
16 0.86
17 0.84
18 0.77
19 0.69
20 0.6
21 0.52
22 0.43
23 0.33
24 0.28
25 0.2
26 0.18
27 0.15
28 0.14
29 0.14
30 0.13
31 0.16
32 0.13
33 0.13
34 0.16
35 0.17
36 0.2
37 0.22
38 0.27
39 0.25
40 0.25
41 0.26
42 0.25
43 0.26
44 0.24
45 0.23
46 0.19
47 0.18
48 0.18