Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3BT87

Protein Details
Accession M3BT87   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-115YLSRIKTRTGRHILKRRRAKGRSTLSHHydrophilic
NLS Segment(s)
PositionSequence
77-110KPSHVVRKRRHGYLSRIKTRTGRHILKRRRAKGR
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPCSRCIRVATSAVRFSTQTTQTTQRRSLSLLSSITPTRPALLASRPTSILPAATLDSQLTGLSISQVRGAKRDTFKPSHVVRKRRHGYLSRIKTRTGRHILKRRRAKGRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.35
4 0.35
5 0.32
6 0.28
7 0.28
8 0.36
9 0.41
10 0.46
11 0.48
12 0.44
13 0.41
14 0.41
15 0.4
16 0.33
17 0.32
18 0.27
19 0.23
20 0.23
21 0.22
22 0.21
23 0.19
24 0.17
25 0.14
26 0.13
27 0.13
28 0.12
29 0.16
30 0.21
31 0.21
32 0.22
33 0.22
34 0.22
35 0.22
36 0.2
37 0.15
38 0.09
39 0.08
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.09
54 0.12
55 0.12
56 0.14
57 0.17
58 0.22
59 0.25
60 0.32
61 0.35
62 0.36
63 0.38
64 0.44
65 0.47
66 0.52
67 0.57
68 0.6
69 0.6
70 0.67
71 0.71
72 0.69
73 0.71
74 0.67
75 0.69
76 0.71
77 0.75
78 0.73
79 0.7
80 0.67
81 0.66
82 0.64
83 0.65
84 0.64
85 0.62
86 0.63
87 0.72
88 0.79
89 0.83
90 0.88
91 0.88
92 0.89
93 0.85
94 0.83
95 0.83