Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3C6X7

Protein Details
Accession M3C6X7    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
17-43LPKITDQPKKQPEQPKKQPQSAPKQPEHydrophilic
60-103QPAPQPKKQPSPPKKQPQPAPPKKQPQPAPKKQQPQPHQPQPQPHydrophilic
NLS Segment(s)
PositionSequence
32-33KK
53-91EQPKKQPQPAPQPKKQPSPPKKQPQPAPPKKQPQPAPKK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MVQPQPEQPQPKPKTTLPKITDQPKKQPEQPKKQPQSAPKQPEQPKTVPKYTEQPKKQPQPAPQPKKQPSPPKKQPQPAPPKKQPQPAPKKQQPQPHQPQPQPYQQQQQTKKPSSAPAPKQYGSGSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.69
4 0.62
5 0.66
6 0.67
7 0.71
8 0.75
9 0.7
10 0.73
11 0.71
12 0.73
13 0.72
14 0.75
15 0.76
16 0.77
17 0.82
18 0.83
19 0.82
20 0.84
21 0.83
22 0.81
23 0.81
24 0.8
25 0.77
26 0.71
27 0.73
28 0.72
29 0.73
30 0.7
31 0.65
32 0.63
33 0.62
34 0.61
35 0.52
36 0.48
37 0.49
38 0.53
39 0.57
40 0.54
41 0.57
42 0.61
43 0.68
44 0.73
45 0.7
46 0.69
47 0.7
48 0.76
49 0.75
50 0.72
51 0.74
52 0.71
53 0.74
54 0.73
55 0.73
56 0.71
57 0.74
58 0.78
59 0.79
60 0.82
61 0.82
62 0.83
63 0.82
64 0.84
65 0.84
66 0.83
67 0.81
68 0.83
69 0.81
70 0.82
71 0.81
72 0.8
73 0.81
74 0.81
75 0.83
76 0.81
77 0.85
78 0.82
79 0.83
80 0.8
81 0.8
82 0.81
83 0.8
84 0.81
85 0.76
86 0.79
87 0.74
88 0.76
89 0.73
90 0.68
91 0.68
92 0.66
93 0.71
94 0.7
95 0.75
96 0.75
97 0.73
98 0.71
99 0.65
100 0.65
101 0.64
102 0.67
103 0.66
104 0.66
105 0.67
106 0.64
107 0.63