Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QKK4

Protein Details
Accession N1QKK4   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
82-102RYIQAYPKKRFPLKRAKEDSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAKTKAQKIRATIDYFEQTYGSTPTLATWQAFCRDVGVNEGNSITQCKKILKSVNVNIVDFVSARKSGQAVTHFASRGALARYIQAYPKKRFPLKRAKEDSFLKMLLIHLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.37
4 0.3
5 0.23
6 0.2
7 0.2
8 0.15
9 0.11
10 0.1
11 0.1
12 0.12
13 0.13
14 0.12
15 0.12
16 0.13
17 0.16
18 0.17
19 0.16
20 0.16
21 0.16
22 0.16
23 0.19
24 0.19
25 0.16
26 0.15
27 0.16
28 0.13
29 0.12
30 0.14
31 0.1
32 0.1
33 0.12
34 0.14
35 0.15
36 0.2
37 0.26
38 0.29
39 0.36
40 0.38
41 0.44
42 0.44
43 0.42
44 0.37
45 0.31
46 0.26
47 0.18
48 0.14
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.12
56 0.14
57 0.15
58 0.17
59 0.21
60 0.21
61 0.2
62 0.2
63 0.16
64 0.16
65 0.15
66 0.14
67 0.11
68 0.13
69 0.15
70 0.16
71 0.21
72 0.26
73 0.33
74 0.37
75 0.45
76 0.52
77 0.59
78 0.66
79 0.7
80 0.73
81 0.75
82 0.81
83 0.82
84 0.78
85 0.78
86 0.75
87 0.72
88 0.65
89 0.55
90 0.45
91 0.36