Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QFA7

Protein Details
Accession N1QFA7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
97-126QATKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRSKEFRGTAKTKGPSKDKKK
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSESQVTLRTRKFIRNPLLGRKQMVVDVLHPSRPNVSKDELREKLAGLYKMNKDQVSVFGFRTQFGGGKSTGFALLYDSAEAMKKFEPHYRLVRYGQATKIEKASRQQRKQRKNRSKEFRGTAKTKGPSKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.21
14 0.25
15 0.24
16 0.25
17 0.24
18 0.23
19 0.26
20 0.29
21 0.3
22 0.26
23 0.3
24 0.32
25 0.37
26 0.46
27 0.43
28 0.42
29 0.4
30 0.37
31 0.36
32 0.35
33 0.31
34 0.24
35 0.27
36 0.27
37 0.31
38 0.34
39 0.29
40 0.25
41 0.24
42 0.26
43 0.23
44 0.22
45 0.19
46 0.2
47 0.2
48 0.19
49 0.19
50 0.16
51 0.14
52 0.13
53 0.14
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.08
71 0.1
72 0.12
73 0.17
74 0.2
75 0.24
76 0.32
77 0.35
78 0.38
79 0.38
80 0.42
81 0.41
82 0.42
83 0.41
84 0.42
85 0.4
86 0.37
87 0.42
88 0.38
89 0.37
90 0.41
91 0.48
92 0.51
93 0.58
94 0.67
95 0.71
96 0.8
97 0.88
98 0.91
99 0.92
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.75
110 0.73
111 0.71
112 0.68
113 0.68
114 0.68