Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3B5Y2

Protein Details
Accession M3B5Y2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
287-311PGATGKTEEKKKRAAKKAAASKAAGHydrophilic
NLS Segment(s)
PositionSequence
55-82KPIRRGRGPASGKGKTSGRGHKGQKQHG
294-311EEKKKRAAKKAAASKAAG
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR030878  Ribosomal_L15  
IPR005749  Ribosomal_L15_bac-type  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00828  Ribosomal_L27A  
Amino Acid Sequences MPPRLQLLRRAAVSIPTQISPAYQPIAPFLYPFLSQQRNASILSSLSDNKGAYNKPIRRGRGPASGKGKTSGRGHKGQKQHGKVPAGFNGGQTPDWIVAGPRGFKNHFSVDMTKVNLNRIQDWINRGRLDPSQPITLKELNESRCVHGVKDGVKLLARGKDELTTPINIVVSRASAEAINTIEKLGGTVTTRYYTNFAIKRIIRGEMDPIHSLQSRINIASADRGVDEVDVDKVADALTQEERRYRFRLPDPTSRKHLEYYRDSAHRGYLSHLVGEGQGPSLFFKTPGATGKTEEKKKRAAKKAAASKAAGNRIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.26
4 0.26
5 0.23
6 0.24
7 0.21
8 0.22
9 0.18
10 0.17
11 0.16
12 0.19
13 0.22
14 0.2
15 0.18
16 0.17
17 0.17
18 0.17
19 0.19
20 0.24
21 0.25
22 0.27
23 0.29
24 0.32
25 0.31
26 0.31
27 0.29
28 0.23
29 0.19
30 0.19
31 0.19
32 0.16
33 0.16
34 0.18
35 0.17
36 0.17
37 0.21
38 0.21
39 0.26
40 0.34
41 0.38
42 0.46
43 0.53
44 0.57
45 0.58
46 0.64
47 0.62
48 0.63
49 0.62
50 0.61
51 0.62
52 0.61
53 0.56
54 0.54
55 0.5
56 0.46
57 0.48
58 0.49
59 0.46
60 0.51
61 0.56
62 0.59
63 0.66
64 0.7
65 0.72
66 0.69
67 0.7
68 0.68
69 0.68
70 0.63
71 0.59
72 0.53
73 0.48
74 0.42
75 0.36
76 0.31
77 0.27
78 0.23
79 0.19
80 0.16
81 0.11
82 0.11
83 0.1
84 0.08
85 0.09
86 0.11
87 0.13
88 0.14
89 0.17
90 0.19
91 0.2
92 0.24
93 0.24
94 0.24
95 0.25
96 0.27
97 0.27
98 0.29
99 0.29
100 0.27
101 0.26
102 0.27
103 0.25
104 0.24
105 0.2
106 0.19
107 0.21
108 0.21
109 0.26
110 0.28
111 0.3
112 0.29
113 0.29
114 0.29
115 0.27
116 0.29
117 0.28
118 0.25
119 0.27
120 0.27
121 0.28
122 0.29
123 0.29
124 0.26
125 0.25
126 0.27
127 0.23
128 0.27
129 0.27
130 0.25
131 0.27
132 0.27
133 0.24
134 0.22
135 0.23
136 0.19
137 0.21
138 0.2
139 0.16
140 0.16
141 0.17
142 0.17
143 0.18
144 0.17
145 0.14
146 0.14
147 0.15
148 0.15
149 0.17
150 0.16
151 0.13
152 0.12
153 0.12
154 0.12
155 0.11
156 0.1
157 0.08
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.05
173 0.05
174 0.06
175 0.07
176 0.08
177 0.09
178 0.1
179 0.1
180 0.13
181 0.13
182 0.19
183 0.21
184 0.21
185 0.27
186 0.27
187 0.3
188 0.3
189 0.31
190 0.24
191 0.23
192 0.27
193 0.23
194 0.26
195 0.23
196 0.22
197 0.22
198 0.22
199 0.22
200 0.18
201 0.18
202 0.16
203 0.16
204 0.16
205 0.13
206 0.13
207 0.15
208 0.15
209 0.11
210 0.1
211 0.1
212 0.09
213 0.09
214 0.09
215 0.06
216 0.07
217 0.06
218 0.06
219 0.06
220 0.06
221 0.05
222 0.06
223 0.05
224 0.07
225 0.12
226 0.14
227 0.16
228 0.21
229 0.24
230 0.28
231 0.32
232 0.33
233 0.36
234 0.41
235 0.51
236 0.53
237 0.61
238 0.65
239 0.67
240 0.71
241 0.67
242 0.62
243 0.57
244 0.56
245 0.54
246 0.52
247 0.53
248 0.53
249 0.52
250 0.52
251 0.47
252 0.46
253 0.39
254 0.33
255 0.3
256 0.28
257 0.25
258 0.24
259 0.23
260 0.19
261 0.18
262 0.18
263 0.15
264 0.1
265 0.09
266 0.09
267 0.11
268 0.12
269 0.12
270 0.11
271 0.13
272 0.13
273 0.16
274 0.22
275 0.25
276 0.25
277 0.28
278 0.38
279 0.46
280 0.54
281 0.59
282 0.58
283 0.64
284 0.72
285 0.79
286 0.8
287 0.8
288 0.8
289 0.82
290 0.87
291 0.86
292 0.83
293 0.74
294 0.71
295 0.69