Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QP18

Protein Details
Accession N1QP18   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
118-138LMGGKEKKRKKTTTPAWLNRAHydrophilic
NLS Segment(s)
PositionSequence
122-128KEKKRKK
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, mito 3, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008580  PPPDE_dom  
IPR042266  PPPDE_sf  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF05903  Peptidase_C97  
PROSITE View protein in PROSITE  
PS51858  PPPDE  
Amino Acid Sequences ERTEVIINVYDLLPPGRLSTLLWTLGSSLLHSGVVLHSREYAFGGHNKPHTTGVYYTRPLQLPPGGTHRVSISQGYTHHSPAAIQTILQQVSAEFQGQKYHLLKNNCNHFTQALVEALMGGKEKKRKKTTTPAWLNRAAGIGLALPCMVPREWVQGPDVDSADGQLVVEAEEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.11
5 0.11
6 0.15
7 0.18
8 0.18
9 0.18
10 0.17
11 0.17
12 0.18
13 0.17
14 0.13
15 0.1
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.12
22 0.12
23 0.11
24 0.13
25 0.13
26 0.14
27 0.14
28 0.14
29 0.12
30 0.17
31 0.2
32 0.22
33 0.26
34 0.27
35 0.28
36 0.29
37 0.28
38 0.25
39 0.25
40 0.27
41 0.29
42 0.3
43 0.3
44 0.31
45 0.31
46 0.28
47 0.28
48 0.24
49 0.21
50 0.21
51 0.25
52 0.24
53 0.24
54 0.24
55 0.22
56 0.22
57 0.2
58 0.19
59 0.13
60 0.12
61 0.13
62 0.17
63 0.17
64 0.16
65 0.15
66 0.14
67 0.13
68 0.12
69 0.14
70 0.1
71 0.08
72 0.09
73 0.12
74 0.12
75 0.12
76 0.11
77 0.08
78 0.09
79 0.09
80 0.08
81 0.06
82 0.06
83 0.08
84 0.09
85 0.13
86 0.14
87 0.18
88 0.23
89 0.28
90 0.33
91 0.38
92 0.47
93 0.45
94 0.44
95 0.41
96 0.36
97 0.32
98 0.28
99 0.22
100 0.13
101 0.11
102 0.1
103 0.09
104 0.08
105 0.07
106 0.07
107 0.06
108 0.09
109 0.17
110 0.24
111 0.34
112 0.43
113 0.49
114 0.57
115 0.67
116 0.74
117 0.77
118 0.82
119 0.81
120 0.78
121 0.76
122 0.68
123 0.57
124 0.48
125 0.37
126 0.26
127 0.18
128 0.13
129 0.09
130 0.08
131 0.07
132 0.06
133 0.06
134 0.09
135 0.08
136 0.09
137 0.1
138 0.17
139 0.19
140 0.21
141 0.22
142 0.23
143 0.25
144 0.26
145 0.25
146 0.19
147 0.17
148 0.16
149 0.16
150 0.13
151 0.1
152 0.07
153 0.07
154 0.06