Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3C7M7

Protein Details
Accession M3C7M7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-49LNPSTMYKPRSKTKKTKSKPTPKKPTAKKRKKTPASLSEDEHydrophilic
NLS Segment(s)
PositionSequence
16-41KPRSKTKKTKSKPTPKKPTAKKRKKT
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MAKDLECLLNPSTMYKPRSKTKKTKSKPTPKKPTAKKRKKTPASLSEDESSDDPDNPSAQTGTQTGTSGQTDANNQDPPSTDQDNSDTGSQTDRNNQDPPSTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.48
5 0.58
6 0.65
7 0.7
8 0.75
9 0.82
10 0.84
11 0.89
12 0.9
13 0.91
14 0.93
15 0.93
16 0.93
17 0.91
18 0.93
19 0.92
20 0.92
21 0.93
22 0.92
23 0.91
24 0.9
25 0.92
26 0.9
27 0.89
28 0.87
29 0.86
30 0.84
31 0.76
32 0.69
33 0.59
34 0.51
35 0.42
36 0.32
37 0.25
38 0.16
39 0.14
40 0.11
41 0.1
42 0.1
43 0.09
44 0.09
45 0.07
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.11
54 0.11
55 0.1
56 0.1
57 0.1
58 0.11
59 0.13
60 0.16
61 0.17
62 0.16
63 0.17
64 0.19
65 0.21
66 0.25
67 0.26
68 0.24
69 0.23
70 0.26
71 0.27
72 0.26
73 0.24
74 0.19
75 0.16
76 0.2
77 0.2
78 0.2
79 0.28
80 0.3
81 0.33
82 0.36
83 0.37