Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QH18

Protein Details
Accession N1QH18    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
251-284TSQVKELRRDHMKKKDRKRPNRRGGKTTNQHMVGBasic
NLS Segment(s)
PositionSequence
258-276RRDHMKKKDRKRPNRRGGK
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
IPR003166  TFIIE_bsu_DNA-bd  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0003677  F:DNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
PF02186  TFIIE_beta  
PROSITE View protein in PROSITE  
PS51351  TFIIE_BETA_C  
Amino Acid Sequences MSLSSKFASYKQELADTASRNIASARPAGSSTVPTRTSTPKPAAPAASADTPKRTHEEAFSAAAAPGVPQASGQELLTQVHYAIDKLKQNKLEAIAFDDLINYLSLPIDAQRRIPLIKRALQDSDRVEYIPKKSSANGKESFRYRPKHPVTNAEELKNYLARQQTAQGIPVKDLKDGWPDCQKAIDQLEREHFLLATRNKKDNTAKMIWPDSPACHVEIALEFRDFWLKTKLPTTEGEVRNELEKASITPTSQVKELRRDHMKKKDRKRPNRRGGKTTNQHMVGILKDYTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.36
4 0.34
5 0.33
6 0.3
7 0.26
8 0.27
9 0.23
10 0.2
11 0.19
12 0.19
13 0.17
14 0.17
15 0.19
16 0.2
17 0.23
18 0.23
19 0.27
20 0.27
21 0.27
22 0.31
23 0.35
24 0.4
25 0.42
26 0.45
27 0.42
28 0.45
29 0.48
30 0.46
31 0.4
32 0.37
33 0.33
34 0.34
35 0.33
36 0.3
37 0.3
38 0.3
39 0.31
40 0.33
41 0.31
42 0.27
43 0.27
44 0.3
45 0.28
46 0.28
47 0.27
48 0.23
49 0.2
50 0.18
51 0.15
52 0.1
53 0.09
54 0.07
55 0.06
56 0.05
57 0.06
58 0.08
59 0.09
60 0.09
61 0.09
62 0.09
63 0.1
64 0.11
65 0.11
66 0.09
67 0.09
68 0.09
69 0.08
70 0.1
71 0.14
72 0.19
73 0.23
74 0.28
75 0.3
76 0.31
77 0.33
78 0.34
79 0.31
80 0.26
81 0.27
82 0.23
83 0.2
84 0.18
85 0.16
86 0.13
87 0.11
88 0.1
89 0.06
90 0.05
91 0.04
92 0.04
93 0.04
94 0.07
95 0.1
96 0.1
97 0.11
98 0.13
99 0.15
100 0.17
101 0.19
102 0.24
103 0.25
104 0.31
105 0.31
106 0.32
107 0.34
108 0.34
109 0.36
110 0.31
111 0.28
112 0.23
113 0.21
114 0.2
115 0.19
116 0.21
117 0.21
118 0.2
119 0.19
120 0.21
121 0.29
122 0.31
123 0.35
124 0.36
125 0.35
126 0.38
127 0.4
128 0.45
129 0.43
130 0.44
131 0.41
132 0.46
133 0.49
134 0.52
135 0.51
136 0.53
137 0.52
138 0.57
139 0.56
140 0.48
141 0.43
142 0.36
143 0.35
144 0.27
145 0.22
146 0.16
147 0.15
148 0.14
149 0.15
150 0.16
151 0.2
152 0.18
153 0.21
154 0.22
155 0.2
156 0.21
157 0.25
158 0.23
159 0.19
160 0.19
161 0.18
162 0.22
163 0.22
164 0.25
165 0.28
166 0.28
167 0.28
168 0.29
169 0.28
170 0.23
171 0.26
172 0.27
173 0.21
174 0.23
175 0.26
176 0.27
177 0.27
178 0.23
179 0.19
180 0.16
181 0.21
182 0.24
183 0.29
184 0.32
185 0.37
186 0.37
187 0.43
188 0.49
189 0.48
190 0.5
191 0.47
192 0.45
193 0.45
194 0.48
195 0.42
196 0.39
197 0.34
198 0.28
199 0.26
200 0.24
201 0.2
202 0.17
203 0.16
204 0.14
205 0.14
206 0.16
207 0.14
208 0.13
209 0.12
210 0.12
211 0.17
212 0.17
213 0.17
214 0.21
215 0.21
216 0.23
217 0.29
218 0.31
219 0.29
220 0.3
221 0.35
222 0.38
223 0.4
224 0.42
225 0.38
226 0.37
227 0.36
228 0.35
229 0.27
230 0.19
231 0.16
232 0.13
233 0.14
234 0.15
235 0.13
236 0.18
237 0.21
238 0.22
239 0.26
240 0.31
241 0.33
242 0.41
243 0.45
244 0.49
245 0.57
246 0.63
247 0.69
248 0.74
249 0.79
250 0.8
251 0.86
252 0.87
253 0.88
254 0.92
255 0.93
256 0.94
257 0.94
258 0.96
259 0.93
260 0.92
261 0.91
262 0.9
263 0.89
264 0.86
265 0.84
266 0.75
267 0.66
268 0.58
269 0.51
270 0.42
271 0.35
272 0.28