Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3C3F4

Protein Details
Accession M3C3F4    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-61ETSATRQDKTRRARRDKTRRDKRDEIRRDERDBasic
88-127QDESNETRRERRERRERQDKTRQAQRDKTRRARRDETRRDBasic
NLS Segment(s)
PositionSequence
38-57KTRRARRDKTRRDKRDEIRR
94-126TRRERRERRERQDKTRQAQRDKTRRARRDETRR
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MYLRQNIRILPASITRATRQDETRATRQDETSATRQDKTRRARRDKTRRDKRDEIRRDERDETRRDESDKTRQDETRRDESDKRGERQDESNETRRERRERRERQDKTRQAQRDKTRRARRDETRRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.31
4 0.34
5 0.36
6 0.34
7 0.37
8 0.41
9 0.45
10 0.51
11 0.53
12 0.53
13 0.51
14 0.49
15 0.45
16 0.4
17 0.39
18 0.37
19 0.38
20 0.36
21 0.36
22 0.4
23 0.44
24 0.49
25 0.53
26 0.57
27 0.61
28 0.68
29 0.75
30 0.82
31 0.86
32 0.89
33 0.9
34 0.92
35 0.91
36 0.9
37 0.9
38 0.88
39 0.88
40 0.85
41 0.83
42 0.82
43 0.77
44 0.73
45 0.68
46 0.65
47 0.61
48 0.55
49 0.51
50 0.45
51 0.42
52 0.39
53 0.38
54 0.36
55 0.39
56 0.42
57 0.41
58 0.41
59 0.43
60 0.46
61 0.49
62 0.51
63 0.5
64 0.47
65 0.48
66 0.48
67 0.5
68 0.56
69 0.55
70 0.51
71 0.49
72 0.47
73 0.46
74 0.47
75 0.48
76 0.46
77 0.46
78 0.52
79 0.5
80 0.52
81 0.56
82 0.57
83 0.61
84 0.61
85 0.65
86 0.68
87 0.74
88 0.81
89 0.87
90 0.88
91 0.88
92 0.91
93 0.9
94 0.87
95 0.86
96 0.85
97 0.83
98 0.84
99 0.85
100 0.85
101 0.86
102 0.88
103 0.89
104 0.88
105 0.88
106 0.88
107 0.88