Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QI23

Protein Details
Accession N1QI23    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-64EEAIKRLKNKRIPWKKDVYQVYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 22, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences QRVEYLIDLTKLFVAAIATIGTTKGPTIYLVLVYYNQLFDILEEAIKRLKNKRIPWKKDVYQVYEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.06
5 0.05
6 0.05
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.04
27 0.06
28 0.05
29 0.06
30 0.06
31 0.07
32 0.1
33 0.12
34 0.16
35 0.21
36 0.29
37 0.37
38 0.47
39 0.57
40 0.66
41 0.72
42 0.77
43 0.81
44 0.79
45 0.8
46 0.78
47 0.74