Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DVY3

Protein Details
Accession B0DVY3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-42DENSALAPKPKKRHVNKAPTSEVIHydrophilic
NLS Segment(s)
PositionSequence
28-31PKKR
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 7, mito 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_312317  -  
Amino Acid Sequences MTTPLILGAKPSVGKRGIDENSALAPKPKKRHVNKAPTSEVIEIESADPPPTGRVITIATTSSLRVASTPPPAPDTPVILPTPLRPSDPDKPLSSSPSITPDKQAPIIAMSRLEPMEIPITTIPTPTSIVPEGTPTSTNPVATTSLSSTTTPNLSTPLSPSIVNPIIEAPPQAAMPSTTGRLSSQSSAEEAAQEGMVTHQSRFNPLTGLKVPKPPFKVPAPPAMTSAPTVVQPVPKKGKLMVPSKTSLTARNLYALDYEKDHSVTNTEFKEIWDNLDAETLKRYEALSKQRKAAMKATSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.35
4 0.34
5 0.34
6 0.34
7 0.3
8 0.31
9 0.32
10 0.3
11 0.27
12 0.32
13 0.37
14 0.44
15 0.52
16 0.58
17 0.65
18 0.76
19 0.8
20 0.85
21 0.86
22 0.86
23 0.83
24 0.76
25 0.71
26 0.61
27 0.51
28 0.41
29 0.32
30 0.23
31 0.19
32 0.17
33 0.13
34 0.12
35 0.11
36 0.1
37 0.11
38 0.11
39 0.1
40 0.09
41 0.1
42 0.11
43 0.12
44 0.14
45 0.13
46 0.13
47 0.14
48 0.14
49 0.14
50 0.12
51 0.1
52 0.1
53 0.11
54 0.14
55 0.19
56 0.22
57 0.22
58 0.26
59 0.26
60 0.29
61 0.28
62 0.29
63 0.24
64 0.24
65 0.23
66 0.2
67 0.2
68 0.19
69 0.24
70 0.2
71 0.2
72 0.2
73 0.26
74 0.34
75 0.38
76 0.4
77 0.36
78 0.39
79 0.4
80 0.42
81 0.37
82 0.3
83 0.26
84 0.29
85 0.31
86 0.27
87 0.28
88 0.27
89 0.27
90 0.27
91 0.26
92 0.19
93 0.17
94 0.18
95 0.16
96 0.13
97 0.12
98 0.12
99 0.12
100 0.11
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.11
108 0.11
109 0.11
110 0.1
111 0.09
112 0.1
113 0.09
114 0.11
115 0.1
116 0.1
117 0.1
118 0.12
119 0.12
120 0.12
121 0.12
122 0.1
123 0.14
124 0.14
125 0.14
126 0.12
127 0.12
128 0.12
129 0.12
130 0.13
131 0.09
132 0.1
133 0.11
134 0.12
135 0.11
136 0.11
137 0.11
138 0.1
139 0.1
140 0.1
141 0.09
142 0.09
143 0.1
144 0.11
145 0.12
146 0.12
147 0.11
148 0.15
149 0.16
150 0.16
151 0.14
152 0.13
153 0.13
154 0.13
155 0.13
156 0.08
157 0.07
158 0.07
159 0.06
160 0.05
161 0.05
162 0.07
163 0.08
164 0.09
165 0.08
166 0.09
167 0.1
168 0.12
169 0.13
170 0.13
171 0.13
172 0.12
173 0.13
174 0.13
175 0.13
176 0.11
177 0.09
178 0.08
179 0.07
180 0.06
181 0.05
182 0.05
183 0.08
184 0.09
185 0.09
186 0.12
187 0.12
188 0.16
189 0.18
190 0.18
191 0.18
192 0.17
193 0.22
194 0.24
195 0.3
196 0.29
197 0.36
198 0.39
199 0.43
200 0.48
201 0.46
202 0.47
203 0.45
204 0.52
205 0.47
206 0.53
207 0.51
208 0.46
209 0.46
210 0.42
211 0.38
212 0.29
213 0.27
214 0.18
215 0.14
216 0.15
217 0.14
218 0.19
219 0.2
220 0.28
221 0.34
222 0.35
223 0.37
224 0.37
225 0.42
226 0.44
227 0.49
228 0.48
229 0.45
230 0.47
231 0.47
232 0.49
233 0.44
234 0.41
235 0.39
236 0.36
237 0.32
238 0.33
239 0.31
240 0.27
241 0.28
242 0.27
243 0.23
244 0.21
245 0.22
246 0.19
247 0.2
248 0.2
249 0.18
250 0.18
251 0.19
252 0.23
253 0.22
254 0.23
255 0.23
256 0.23
257 0.3
258 0.27
259 0.28
260 0.25
261 0.24
262 0.22
263 0.28
264 0.27
265 0.2
266 0.24
267 0.21
268 0.17
269 0.18
270 0.18
271 0.19
272 0.26
273 0.37
274 0.43
275 0.48
276 0.54
277 0.59
278 0.64
279 0.63
280 0.62
281 0.58