Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1QE91

Protein Details
Accession N1QE91    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-71TMYKPRSKTKKTKSKLTLKKPTAKKRKKTPASLSEDESHydrophilic
NLS Segment(s)
PositionSequence
37-62KPRSKTKKTKSKLTLKKPTAKKRKKT
Subcellular Location(s) nucl 18.5, cyto_nucl 11.833, cyto_mito 4.333, cyto 4, mito 3.5
Family & Domain DBs
Amino Acid Sequences MGTTYPSGLLKEWNVWLDNYVVAPYSSGLVNPSTMYKPRSKTKKTKSKLTLKKPTAKKRKKTPASLSEDESSDNPDNPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.18
5 0.16
6 0.13
7 0.11
8 0.09
9 0.08
10 0.08
11 0.07
12 0.07
13 0.06
14 0.06
15 0.07
16 0.07
17 0.07
18 0.07
19 0.09
20 0.1
21 0.13
22 0.16
23 0.2
24 0.24
25 0.32
26 0.41
27 0.47
28 0.56
29 0.64
30 0.72
31 0.73
32 0.79
33 0.8
34 0.81
35 0.83
36 0.84
37 0.84
38 0.8
39 0.84
40 0.84
41 0.86
42 0.86
43 0.86
44 0.85
45 0.86
46 0.89
47 0.89
48 0.89
49 0.89
50 0.88
51 0.87
52 0.81
53 0.75
54 0.66
55 0.57
56 0.49
57 0.39
58 0.35
59 0.28
60 0.26