Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AZS8

Protein Details
Accession M3AZS8   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-125QEESGECGNQKKKKRHYRRHVQHMRRALBasic
NLS Segment(s)
PositionSequence
108-118KKKKRHYRRHV
Subcellular Location(s) nucl 12.5, cyto_nucl 10.666, mito_nucl 9.499, cyto 6.5, cyto_mito 6.499, mito 5
Family & Domain DBs
Amino Acid Sequences MKLLNMAFISVLAVLAHARSCDDKFDDCMESWIEQDFPDITKLPQAYYDDFEACQNKYYEADGHTCKSDNGGDDGDGDKCTKEQKEKGECDDDCTPEQEESGECGNQKKKKRHYRRHVQHMRRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.07
6 0.1
7 0.11
8 0.14
9 0.17
10 0.19
11 0.21
12 0.24
13 0.25
14 0.23
15 0.24
16 0.22
17 0.19
18 0.18
19 0.16
20 0.13
21 0.1
22 0.11
23 0.1
24 0.09
25 0.1
26 0.11
27 0.1
28 0.13
29 0.14
30 0.13
31 0.15
32 0.17
33 0.17
34 0.18
35 0.19
36 0.16
37 0.16
38 0.18
39 0.17
40 0.15
41 0.16
42 0.14
43 0.13
44 0.13
45 0.13
46 0.13
47 0.12
48 0.16
49 0.15
50 0.16
51 0.16
52 0.16
53 0.14
54 0.14
55 0.14
56 0.11
57 0.11
58 0.11
59 0.1
60 0.11
61 0.12
62 0.11
63 0.11
64 0.1
65 0.08
66 0.08
67 0.12
68 0.14
69 0.2
70 0.25
71 0.34
72 0.43
73 0.47
74 0.51
75 0.55
76 0.52
77 0.52
78 0.5
79 0.44
80 0.36
81 0.34
82 0.31
83 0.23
84 0.23
85 0.17
86 0.14
87 0.14
88 0.15
89 0.15
90 0.14
91 0.21
92 0.29
93 0.36
94 0.44
95 0.52
96 0.6
97 0.7
98 0.81
99 0.85
100 0.88
101 0.93
102 0.95
103 0.96
104 0.96
105 0.95