Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3C8E0

Protein Details
Accession M3C8E0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-55GPYPRVLDRRRQPRHKPRISDRTWBasic
NLS Segment(s)
PositionSequence
41-49RRQPRHKPR
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MITLLAPRSPRTATHSTANSSILRQECSQESGPYPRVLDRRRQPRHKPRISDRTWWNRRRSFWYSRPRQQEQRVYYSAACHLCGRREKARPCVCFTSNARFRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.4
4 0.41
5 0.41
6 0.34
7 0.3
8 0.31
9 0.25
10 0.24
11 0.22
12 0.23
13 0.21
14 0.25
15 0.26
16 0.23
17 0.23
18 0.26
19 0.28
20 0.26
21 0.25
22 0.25
23 0.31
24 0.32
25 0.39
26 0.42
27 0.51
28 0.6
29 0.68
30 0.75
31 0.78
32 0.87
33 0.85
34 0.85
35 0.83
36 0.84
37 0.79
38 0.76
39 0.73
40 0.73
41 0.75
42 0.74
43 0.73
44 0.67
45 0.67
46 0.67
47 0.65
48 0.63
49 0.62
50 0.66
51 0.67
52 0.71
53 0.76
54 0.75
55 0.77
56 0.77
57 0.77
58 0.71
59 0.69
60 0.62
61 0.57
62 0.5
63 0.43
64 0.4
65 0.31
66 0.27
67 0.24
68 0.24
69 0.28
70 0.34
71 0.39
72 0.42
73 0.5
74 0.55
75 0.63
76 0.7
77 0.68
78 0.68
79 0.69
80 0.62
81 0.62
82 0.6
83 0.61