Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QH71

Protein Details
Accession N1QH71    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
136-157AKSLGAKRKWHEKFRASSKKTAHydrophilic
NLS Segment(s)
PositionSequence
138-156SLGAKRKWHEKFRASSKKT
Subcellular Location(s) cyto_mito 8.333, cyto 8, mito 7.5, extr 6, cyto_nucl 5.333, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019128  Dcc1  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0006260  P:DNA replication  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09724  Dcc1  
Amino Acid Sequences MTVAVADGIAVDSPFPENDIPPFAIDLPGDWPQGLVRSVFSSVSTSTPGGHLAIDKQRAVNFAGVNLLQAKSEGRAIDAIRFLQVWRDAMPEAWRDGCEFAVLQGYYTLTDHAKSIKYVDTTAAATAALEATAKEAKSLGAKRKWHEKFRASSKKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.1
5 0.12
6 0.16
7 0.16
8 0.15
9 0.17
10 0.15
11 0.16
12 0.14
13 0.13
14 0.14
15 0.15
16 0.15
17 0.14
18 0.13
19 0.13
20 0.15
21 0.15
22 0.11
23 0.09
24 0.11
25 0.12
26 0.12
27 0.12
28 0.12
29 0.12
30 0.13
31 0.14
32 0.12
33 0.12
34 0.12
35 0.12
36 0.1
37 0.1
38 0.09
39 0.11
40 0.15
41 0.18
42 0.17
43 0.18
44 0.18
45 0.2
46 0.2
47 0.19
48 0.14
49 0.12
50 0.13
51 0.12
52 0.11
53 0.11
54 0.1
55 0.07
56 0.07
57 0.07
58 0.06
59 0.08
60 0.07
61 0.07
62 0.09
63 0.09
64 0.1
65 0.11
66 0.1
67 0.09
68 0.09
69 0.09
70 0.09
71 0.1
72 0.09
73 0.09
74 0.1
75 0.1
76 0.1
77 0.13
78 0.11
79 0.12
80 0.12
81 0.12
82 0.11
83 0.12
84 0.11
85 0.09
86 0.08
87 0.07
88 0.1
89 0.1
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.07
97 0.08
98 0.08
99 0.11
100 0.11
101 0.11
102 0.13
103 0.16
104 0.17
105 0.17
106 0.18
107 0.17
108 0.17
109 0.16
110 0.14
111 0.1
112 0.09
113 0.08
114 0.07
115 0.05
116 0.04
117 0.04
118 0.06
119 0.09
120 0.09
121 0.09
122 0.1
123 0.11
124 0.19
125 0.26
126 0.33
127 0.38
128 0.45
129 0.51
130 0.61
131 0.69
132 0.71
133 0.74
134 0.74
135 0.76
136 0.81
137 0.86