Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3CUS1

Protein Details
Accession M3CUS1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MYKPRLKTKKTKSKPTPKKPTTKKRKKTPASLSEDEBasic
NLS Segment(s)
PositionSequence
4-28PRLKTKKTKSKPTPKKPTTKKRKKT
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MYKPRLKTKKTKSKPTPKKPTTKKRKKTPASLSEDESSDNPDNPSAQTDPPSTDQDNSDTGGQTDGNNQDPPSTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.95
3 0.95
4 0.92
5 0.93
6 0.93
7 0.93
8 0.93
9 0.93
10 0.92
11 0.92
12 0.94
13 0.91
14 0.9
15 0.9
16 0.88
17 0.86
18 0.78
19 0.71
20 0.61
21 0.53
22 0.43
23 0.33
24 0.27
25 0.19
26 0.17
27 0.13
28 0.12
29 0.12
30 0.12
31 0.15
32 0.12
33 0.12
34 0.14
35 0.15
36 0.18
37 0.2
38 0.24
39 0.23
40 0.23
41 0.23
42 0.23
43 0.23
44 0.22
45 0.2
46 0.16
47 0.15
48 0.14
49 0.14
50 0.12
51 0.16
52 0.17
53 0.19
54 0.21
55 0.21