Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QM85

Protein Details
Accession N1QM85    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MTTTRRRRRRRRNHHPRKEEQQQQPLYNBasic
NLS Segment(s)
PositionSequence
5-18RRRRRRRRNHHPRK
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTTTRRRRRRRRNHHPRKEEQQQQPLYNDNYDDLHSTFSQINSTHGGYSSSNYNHSNINDITTFGEEEVEVEEEEEEEVEEEPRRGRTRTRTRWGEEEEEEKNGNRWLPPSPSPSVSRGGGVIMGRGTVATAVEPIGGYYYETRVVEPEWTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.95
4 0.93
5 0.92
6 0.91
7 0.89
8 0.87
9 0.83
10 0.76
11 0.69
12 0.64
13 0.56
14 0.47
15 0.38
16 0.3
17 0.24
18 0.21
19 0.21
20 0.16
21 0.16
22 0.15
23 0.16
24 0.16
25 0.15
26 0.17
27 0.15
28 0.16
29 0.16
30 0.17
31 0.15
32 0.14
33 0.15
34 0.13
35 0.14
36 0.17
37 0.15
38 0.18
39 0.18
40 0.19
41 0.2
42 0.2
43 0.23
44 0.18
45 0.19
46 0.16
47 0.15
48 0.15
49 0.13
50 0.13
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.03
64 0.03
65 0.04
66 0.04
67 0.05
68 0.05
69 0.07
70 0.1
71 0.12
72 0.13
73 0.18
74 0.28
75 0.39
76 0.48
77 0.57
78 0.61
79 0.63
80 0.68
81 0.68
82 0.62
83 0.53
84 0.48
85 0.39
86 0.35
87 0.32
88 0.25
89 0.22
90 0.19
91 0.18
92 0.14
93 0.15
94 0.16
95 0.2
96 0.24
97 0.28
98 0.3
99 0.32
100 0.34
101 0.35
102 0.35
103 0.31
104 0.27
105 0.22
106 0.19
107 0.18
108 0.15
109 0.14
110 0.1
111 0.09
112 0.08
113 0.08
114 0.07
115 0.05
116 0.05
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.08
126 0.09
127 0.1
128 0.14
129 0.15
130 0.15
131 0.16
132 0.17