Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DFA6

Protein Details
Accession B0DFA6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
76-98APSAPIRKRSKRVRYRSFRRTSSHydrophilic
NLS Segment(s)
PositionSequence
82-89RKRSKRVR
Subcellular Location(s) nucl 8.5, mito 8, cyto_nucl 7.5, cyto 5.5, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG lbc:LACBIDRAFT_328565  -  
Amino Acid Sequences MHHFRYSKRKCYVSHFFSGLCLSTTVTALFSLPHSEPIALDRLIDPSTRRTFKKQKYSIPTWLSSPQLPPSILFHAPSAPIRKRSKRVRYRSFRRTSSLPSIQCLAQFSPSERPRFDARLNLWTSLDVQNFRRNDFQSATKPEFSSPMDVDTSYVIDMACTCFISTRSTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.6
3 0.52
4 0.47
5 0.44
6 0.36
7 0.26
8 0.2
9 0.14
10 0.12
11 0.12
12 0.11
13 0.1
14 0.09
15 0.08
16 0.08
17 0.08
18 0.11
19 0.11
20 0.13
21 0.14
22 0.14
23 0.14
24 0.15
25 0.18
26 0.14
27 0.14
28 0.12
29 0.13
30 0.14
31 0.15
32 0.14
33 0.18
34 0.26
35 0.3
36 0.32
37 0.39
38 0.49
39 0.57
40 0.67
41 0.68
42 0.7
43 0.74
44 0.77
45 0.77
46 0.71
47 0.63
48 0.55
49 0.5
50 0.43
51 0.35
52 0.3
53 0.24
54 0.22
55 0.21
56 0.18
57 0.18
58 0.2
59 0.19
60 0.18
61 0.16
62 0.14
63 0.15
64 0.16
65 0.2
66 0.19
67 0.26
68 0.33
69 0.38
70 0.46
71 0.55
72 0.64
73 0.68
74 0.76
75 0.79
76 0.83
77 0.87
78 0.89
79 0.86
80 0.79
81 0.73
82 0.66
83 0.61
84 0.58
85 0.56
86 0.46
87 0.39
88 0.38
89 0.34
90 0.31
91 0.27
92 0.19
93 0.15
94 0.15
95 0.16
96 0.23
97 0.27
98 0.3
99 0.28
100 0.31
101 0.33
102 0.37
103 0.37
104 0.35
105 0.34
106 0.39
107 0.4
108 0.38
109 0.34
110 0.3
111 0.31
112 0.27
113 0.27
114 0.21
115 0.23
116 0.28
117 0.29
118 0.31
119 0.34
120 0.32
121 0.34
122 0.34
123 0.37
124 0.38
125 0.45
126 0.47
127 0.45
128 0.44
129 0.4
130 0.41
131 0.37
132 0.34
133 0.27
134 0.25
135 0.23
136 0.22
137 0.22
138 0.19
139 0.18
140 0.12
141 0.12
142 0.09
143 0.08
144 0.08
145 0.1
146 0.1
147 0.09
148 0.1
149 0.11
150 0.12