Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B2R3

Protein Details
Accession M3B2R3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-76YVSCVYFHRRRKVRKGRYPGSQTKAHydrophilic
NLS Segment(s)
PositionSequence
60-67RRRKVRKG
Subcellular Location(s) plas 19, mito 3, E.R. 2, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MGDLRYRLSLTILNIFFPPLALLIVCGPDMTFAVNCLLYIFAIIPSHIHGLYVSCVYFHRRRKVRKGRYPGSQTKALIYSPHVLNGGAKQSLVDSLYWAEKEKSPRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.17
5 0.15
6 0.07
7 0.07
8 0.06
9 0.06
10 0.06
11 0.07
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.05
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.07
39 0.08
40 0.06
41 0.06
42 0.06
43 0.12
44 0.19
45 0.25
46 0.33
47 0.41
48 0.49
49 0.6
50 0.71
51 0.77
52 0.8
53 0.84
54 0.81
55 0.83
56 0.84
57 0.81
58 0.75
59 0.7
60 0.6
61 0.52
62 0.47
63 0.38
64 0.3
65 0.25
66 0.25
67 0.19
68 0.21
69 0.19
70 0.17
71 0.18
72 0.19
73 0.2
74 0.15
75 0.14
76 0.13
77 0.13
78 0.14
79 0.14
80 0.11
81 0.09
82 0.11
83 0.14
84 0.15
85 0.17
86 0.18
87 0.22