Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QGQ5

Protein Details
Accession N1QGQ5   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ADLARVRDNQRRSRARRKEYLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences LSPSQKSADLARVRDNQRRSRARRKEYLQELETKYWTCEQVGVGASAEIQAAARLVVNENKRLRALLMKYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.6
4 0.64
5 0.72
6 0.73
7 0.76
8 0.8
9 0.81
10 0.82
11 0.8
12 0.79
13 0.78
14 0.77
15 0.67
16 0.64
17 0.59
18 0.51
19 0.47
20 0.37
21 0.29
22 0.23
23 0.21
24 0.14
25 0.12
26 0.1
27 0.11
28 0.11
29 0.11
30 0.1
31 0.09
32 0.08
33 0.08
34 0.07
35 0.04
36 0.04
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.07
43 0.13
44 0.16
45 0.24
46 0.27
47 0.3
48 0.31
49 0.31
50 0.31
51 0.34