Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3D703

Protein Details
Accession M3D703   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
150-169VAKNKDKAFKQKSTPNATKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.333, mito 6.5, cyto_mito 5.833, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
Amino Acid Sequences MPPKAPQDARSDNLTIKERQVAAAAHARASKQKGQASQPHGTMRYGDLPRISNGTGPAPQPAAGMQWEQMPRTVLEVYRVAHNLDTPASFTSPRNQALLTNPGIGRHSPTMRRAKHQQRQSEVKLATQVRKHFNAAAVNETEVVAGMQYVAKNKDKAFKQKSTPNATKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.38
3 0.34
4 0.36
5 0.32
6 0.3
7 0.3
8 0.24
9 0.24
10 0.29
11 0.27
12 0.24
13 0.25
14 0.25
15 0.28
16 0.32
17 0.34
18 0.33
19 0.38
20 0.4
21 0.46
22 0.54
23 0.56
24 0.55
25 0.54
26 0.51
27 0.48
28 0.43
29 0.37
30 0.31
31 0.32
32 0.28
33 0.26
34 0.23
35 0.23
36 0.24
37 0.26
38 0.23
39 0.16
40 0.17
41 0.18
42 0.17
43 0.16
44 0.16
45 0.14
46 0.14
47 0.13
48 0.11
49 0.1
50 0.09
51 0.09
52 0.08
53 0.12
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.14
60 0.14
61 0.1
62 0.12
63 0.13
64 0.13
65 0.14
66 0.15
67 0.13
68 0.12
69 0.12
70 0.1
71 0.09
72 0.08
73 0.07
74 0.07
75 0.08
76 0.09
77 0.09
78 0.14
79 0.17
80 0.18
81 0.18
82 0.17
83 0.18
84 0.2
85 0.24
86 0.2
87 0.19
88 0.18
89 0.18
90 0.19
91 0.18
92 0.18
93 0.17
94 0.2
95 0.2
96 0.28
97 0.37
98 0.39
99 0.45
100 0.52
101 0.59
102 0.64
103 0.69
104 0.69
105 0.68
106 0.74
107 0.72
108 0.7
109 0.6
110 0.53
111 0.52
112 0.48
113 0.45
114 0.42
115 0.44
116 0.41
117 0.43
118 0.44
119 0.39
120 0.39
121 0.39
122 0.36
123 0.34
124 0.29
125 0.27
126 0.25
127 0.23
128 0.18
129 0.12
130 0.1
131 0.06
132 0.05
133 0.04
134 0.06
135 0.07
136 0.11
137 0.16
138 0.2
139 0.24
140 0.27
141 0.35
142 0.41
143 0.51
144 0.56
145 0.6
146 0.64
147 0.7
148 0.77
149 0.78
150 0.8