Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3D0P7

Protein Details
Accession M3D0P7    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-65DKIQERYRDKLRQKAREKGVDBasic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010591  ATP11  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0065003  P:protein-containing complex assembly  
Pfam View protein in Pfam  
PF06644  ATP11  
Amino Acid Sequences MNSSSSLLFRRAASRCHPSSLQRSQRRWAQVHDVRFFALHPPLNDKIQERYRDKLRQKAREKGVDDVEELKQVYQERISQLRKESLVPGLNAPLTEQHQPPPTPQNASASIPYQPPPPPQPLVDPAIQKVTKSESPVKTLASFIDVEKTAQLPHKEIETIWRLRHVRDPQSLCAAMQADTFKRIFQTAKKHPQFILPLPRPEQGAEIHFLQWTFPTETTATVLFTHLAEFKMRGEYAQPHTTITHHLDLLDSKGLVLLEGRVQENRGISVDEGKFLLMNLQKFYGFEAISAVAKESKEKRGKLMEQFSGGDETFNVEELLEEAEKVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.5
4 0.53
5 0.52
6 0.59
7 0.64
8 0.67
9 0.68
10 0.7
11 0.72
12 0.75
13 0.77
14 0.71
15 0.66
16 0.67
17 0.64
18 0.67
19 0.63
20 0.56
21 0.47
22 0.44
23 0.38
24 0.31
25 0.31
26 0.25
27 0.24
28 0.29
29 0.31
30 0.34
31 0.36
32 0.34
33 0.36
34 0.4
35 0.48
36 0.46
37 0.5
38 0.56
39 0.63
40 0.68
41 0.69
42 0.72
43 0.73
44 0.78
45 0.8
46 0.8
47 0.79
48 0.75
49 0.71
50 0.67
51 0.58
52 0.51
53 0.45
54 0.37
55 0.3
56 0.28
57 0.22
58 0.18
59 0.18
60 0.18
61 0.16
62 0.18
63 0.21
64 0.29
65 0.32
66 0.34
67 0.36
68 0.39
69 0.38
70 0.37
71 0.35
72 0.32
73 0.32
74 0.29
75 0.26
76 0.23
77 0.22
78 0.2
79 0.18
80 0.15
81 0.14
82 0.17
83 0.17
84 0.19
85 0.24
86 0.25
87 0.28
88 0.32
89 0.33
90 0.33
91 0.33
92 0.34
93 0.31
94 0.33
95 0.31
96 0.25
97 0.24
98 0.22
99 0.22
100 0.21
101 0.2
102 0.22
103 0.25
104 0.28
105 0.28
106 0.27
107 0.3
108 0.3
109 0.31
110 0.3
111 0.27
112 0.24
113 0.28
114 0.27
115 0.24
116 0.21
117 0.22
118 0.21
119 0.24
120 0.32
121 0.27
122 0.31
123 0.33
124 0.32
125 0.28
126 0.27
127 0.22
128 0.16
129 0.15
130 0.11
131 0.12
132 0.11
133 0.11
134 0.1
135 0.11
136 0.1
137 0.13
138 0.14
139 0.12
140 0.13
141 0.14
142 0.13
143 0.13
144 0.17
145 0.19
146 0.21
147 0.2
148 0.26
149 0.25
150 0.26
151 0.34
152 0.34
153 0.35
154 0.4
155 0.43
156 0.38
157 0.42
158 0.4
159 0.33
160 0.28
161 0.23
162 0.15
163 0.13
164 0.13
165 0.1
166 0.12
167 0.12
168 0.11
169 0.1
170 0.12
171 0.13
172 0.17
173 0.26
174 0.34
175 0.45
176 0.48
177 0.5
178 0.49
179 0.52
180 0.51
181 0.47
182 0.48
183 0.41
184 0.43
185 0.43
186 0.43
187 0.39
188 0.35
189 0.31
190 0.21
191 0.19
192 0.17
193 0.15
194 0.15
195 0.14
196 0.14
197 0.12
198 0.11
199 0.13
200 0.12
201 0.11
202 0.13
203 0.13
204 0.14
205 0.15
206 0.15
207 0.12
208 0.1
209 0.11
210 0.09
211 0.09
212 0.09
213 0.09
214 0.1
215 0.09
216 0.1
217 0.1
218 0.13
219 0.13
220 0.12
221 0.14
222 0.19
223 0.24
224 0.28
225 0.27
226 0.26
227 0.26
228 0.27
229 0.29
230 0.27
231 0.23
232 0.19
233 0.19
234 0.19
235 0.19
236 0.2
237 0.17
238 0.13
239 0.1
240 0.11
241 0.11
242 0.1
243 0.09
244 0.08
245 0.08
246 0.11
247 0.12
248 0.12
249 0.13
250 0.15
251 0.16
252 0.16
253 0.15
254 0.14
255 0.13
256 0.2
257 0.2
258 0.19
259 0.18
260 0.17
261 0.16
262 0.14
263 0.2
264 0.16
265 0.18
266 0.18
267 0.2
268 0.2
269 0.2
270 0.22
271 0.2
272 0.16
273 0.14
274 0.15
275 0.14
276 0.15
277 0.15
278 0.14
279 0.13
280 0.13
281 0.2
282 0.23
283 0.32
284 0.4
285 0.41
286 0.48
287 0.55
288 0.62
289 0.65
290 0.69
291 0.64
292 0.59
293 0.58
294 0.53
295 0.47
296 0.39
297 0.3
298 0.21
299 0.2
300 0.16
301 0.16
302 0.14
303 0.1
304 0.1
305 0.1
306 0.13
307 0.1