Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1QGI7

Protein Details
Accession N1QGI7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-94MIKSNKKKALKAKKAAAAKVHydrophilic
NLS Segment(s)
PositionSequence
79-93NKKKALKAKKAAAAK
Subcellular Location(s) plas 18, E.R. 5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MASNTLLDRLVGLAMLVLASTVFLYYTIWTLLMPFVDDSHPIQQLFPPRVWAIRIPVILLLVGGAVVGSFLSVVMIKSNKKKALKAKKAAAAKVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.08
25 0.1
26 0.12
27 0.13
28 0.13
29 0.13
30 0.14
31 0.19
32 0.2
33 0.18
34 0.18
35 0.17
36 0.17
37 0.18
38 0.17
39 0.15
40 0.17
41 0.17
42 0.15
43 0.15
44 0.14
45 0.13
46 0.11
47 0.07
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.07
62 0.1
63 0.15
64 0.23
65 0.31
66 0.38
67 0.42
68 0.5
69 0.58
70 0.66
71 0.73
72 0.75
73 0.76
74 0.77
75 0.8