Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3D8G6

Protein Details
Accession M3D8G6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
168-202PPPPPRTPTREQQHHHRKKESRRNRTGRTPPPAPMBasic
NLS Segment(s)
PositionSequence
136-152PPRRVKEKERRGAAAAA
158-199GRETRTPPPPPPPPPRTPTREQQHHHRKKESRRNRTGRTPPP
Subcellular Location(s) mito 10.5, nucl 9, cyto_mito 7.5, cyto 3.5, plas 3
Family & Domain DBs
Amino Acid Sequences MCVCVLTQTCYFSLQLLFSRKWVLDHARNQIITTFNEMRAMRIEAHRNYLQTLPFYTLYHRYNGAPPLGAAQLQLIHSQISSANHTLQQGVDQDWRTSCMQYPQVLDYYFNLVSVRLPREDDTVITEPVFGVPKDPPRRVKEKERRGAAAAAESAEYGRETRTPPPPPPPPPRTPTREQQHHHRKKESRRNRTGRTPPPAPMPYHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.25
4 0.25
5 0.24
6 0.28
7 0.27
8 0.27
9 0.31
10 0.33
11 0.37
12 0.43
13 0.5
14 0.52
15 0.52
16 0.51
17 0.48
18 0.42
19 0.34
20 0.35
21 0.29
22 0.23
23 0.29
24 0.29
25 0.27
26 0.27
27 0.28
28 0.23
29 0.25
30 0.32
31 0.28
32 0.35
33 0.35
34 0.33
35 0.33
36 0.34
37 0.3
38 0.24
39 0.24
40 0.21
41 0.2
42 0.2
43 0.21
44 0.24
45 0.24
46 0.24
47 0.24
48 0.22
49 0.25
50 0.27
51 0.25
52 0.18
53 0.17
54 0.17
55 0.16
56 0.14
57 0.11
58 0.08
59 0.09
60 0.09
61 0.1
62 0.08
63 0.07
64 0.07
65 0.07
66 0.09
67 0.09
68 0.11
69 0.11
70 0.12
71 0.13
72 0.14
73 0.14
74 0.12
75 0.12
76 0.11
77 0.11
78 0.14
79 0.13
80 0.13
81 0.13
82 0.16
83 0.15
84 0.15
85 0.14
86 0.15
87 0.17
88 0.18
89 0.19
90 0.17
91 0.18
92 0.18
93 0.18
94 0.14
95 0.15
96 0.13
97 0.12
98 0.11
99 0.09
100 0.1
101 0.13
102 0.14
103 0.11
104 0.13
105 0.13
106 0.16
107 0.16
108 0.15
109 0.18
110 0.18
111 0.18
112 0.16
113 0.16
114 0.13
115 0.14
116 0.15
117 0.08
118 0.08
119 0.1
120 0.19
121 0.27
122 0.32
123 0.39
124 0.43
125 0.52
126 0.57
127 0.65
128 0.67
129 0.71
130 0.75
131 0.73
132 0.7
133 0.65
134 0.61
135 0.5
136 0.42
137 0.31
138 0.23
139 0.17
140 0.14
141 0.11
142 0.09
143 0.09
144 0.06
145 0.07
146 0.09
147 0.11
148 0.17
149 0.25
150 0.3
151 0.35
152 0.43
153 0.51
154 0.58
155 0.66
156 0.68
157 0.68
158 0.68
159 0.72
160 0.71
161 0.68
162 0.69
163 0.7
164 0.72
165 0.69
166 0.75
167 0.78
168 0.81
169 0.83
170 0.83
171 0.82
172 0.83
173 0.9
174 0.9
175 0.89
176 0.9
177 0.91
178 0.9
179 0.92
180 0.91
181 0.9
182 0.88
183 0.81
184 0.75
185 0.74
186 0.7