Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3C3Z7

Protein Details
Accession M3C3Z7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-47KLSKGISKPPRRRQTSLKPLPHydrophilic
NLS Segment(s)
PositionSequence
34-38KPPRR
Subcellular Location(s) nucl 13.5, mito_nucl 12.832, mito 10.5, cyto_nucl 10.333
Family & Domain DBs
Amino Acid Sequences MNQTINNFKQKGRRLPTPFQEPMAPTKLSKGISKPPRRRQTSLKPLPSHAIFPTENTPSKPFRSSSNSNNNTNITLRISFHKGNFSHWNPTTWQPHTFPGVIDATKPLSDLPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.77
4 0.77
5 0.71
6 0.63
7 0.59
8 0.51
9 0.48
10 0.43
11 0.36
12 0.27
13 0.28
14 0.29
15 0.27
16 0.29
17 0.28
18 0.33
19 0.42
20 0.53
21 0.6
22 0.67
23 0.75
24 0.79
25 0.8
26 0.79
27 0.8
28 0.81
29 0.8
30 0.78
31 0.7
32 0.65
33 0.64
34 0.55
35 0.46
36 0.35
37 0.3
38 0.21
39 0.2
40 0.22
41 0.2
42 0.21
43 0.2
44 0.23
45 0.21
46 0.23
47 0.24
48 0.21
49 0.23
50 0.3
51 0.33
52 0.39
53 0.48
54 0.5
55 0.51
56 0.52
57 0.48
58 0.43
59 0.38
60 0.31
61 0.22
62 0.18
63 0.17
64 0.18
65 0.22
66 0.23
67 0.24
68 0.3
69 0.28
70 0.32
71 0.4
72 0.4
73 0.43
74 0.42
75 0.43
76 0.39
77 0.46
78 0.47
79 0.42
80 0.43
81 0.37
82 0.39
83 0.41
84 0.38
85 0.31
86 0.28
87 0.29
88 0.24
89 0.23
90 0.21
91 0.2
92 0.19
93 0.19