Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3D1T4

Protein Details
Accession M3D1T4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-79NSTTLRKKPVQRDCRESRPHTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 8, mito 3, E.R. 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MFLSHRHALHVIVPAVLLPITAMFLSPRHALHVIVEPTSAHVDADCSARWQLAEVLRPNSTTLRKKPVQRDCRESRPHTRLPPVILTALH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.1
5 0.05
6 0.04
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.09
13 0.1
14 0.11
15 0.13
16 0.14
17 0.14
18 0.15
19 0.21
20 0.19
21 0.17
22 0.17
23 0.14
24 0.15
25 0.16
26 0.14
27 0.07
28 0.06
29 0.06
30 0.07
31 0.09
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.1
39 0.11
40 0.16
41 0.18
42 0.21
43 0.21
44 0.22
45 0.22
46 0.24
47 0.28
48 0.31
49 0.34
50 0.4
51 0.45
52 0.53
53 0.62
54 0.68
55 0.72
56 0.73
57 0.77
58 0.76
59 0.81
60 0.82
61 0.79
62 0.79
63 0.76
64 0.76
65 0.74
66 0.74
67 0.69
68 0.65
69 0.62
70 0.55