Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3CWN7

Protein Details
Accession M3CWN7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
244-273KLKIKFKREEKVNSPPRRKARRGTHVTVIEBasic
NLS Segment(s)
PositionSequence
245-265LKIKFKREEKVNSPPRRKARR
Subcellular Location(s) cyto_nucl 13.333, nucl 12, cyto 11.5, mito_nucl 7.499
Family & Domain DBs
Amino Acid Sequences MAVTAVLPGVTISVVAEDRVLQEYPDVEVKDNKKTTTRYIEAVSGQTFSLEFEVTKETPMLGTYLAFHVFVDGTEVDELGLDTGYIRLYGDKGISQGRYLHGGLLQRYCFTDLNIVDHNDHVSQDLMSKLKELGTIRIEVHHKNRSSVHLPSAGFDTLLPATGAVSEKALKGQSVMQARSVEHMMSHSGAPSLLIPPGHQQQRSSSATGREVELKEEIKVKREQKSASPPRRYEEFEVGTAEMKLKIKFKREEKVNSPPRRKARRGTHVTVIELDDDGEIVSETTRPRNAPIDMSKSVPLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.09
6 0.12
7 0.12
8 0.1
9 0.12
10 0.12
11 0.14
12 0.19
13 0.18
14 0.18
15 0.25
16 0.29
17 0.37
18 0.39
19 0.4
20 0.41
21 0.44
22 0.5
23 0.52
24 0.52
25 0.46
26 0.45
27 0.46
28 0.42
29 0.42
30 0.34
31 0.25
32 0.22
33 0.19
34 0.16
35 0.13
36 0.11
37 0.09
38 0.08
39 0.08
40 0.13
41 0.13
42 0.14
43 0.14
44 0.13
45 0.12
46 0.13
47 0.12
48 0.07
49 0.07
50 0.08
51 0.09
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.08
58 0.1
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.05
67 0.05
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.08
78 0.08
79 0.1
80 0.13
81 0.13
82 0.14
83 0.15
84 0.15
85 0.18
86 0.18
87 0.16
88 0.15
89 0.18
90 0.19
91 0.2
92 0.19
93 0.17
94 0.17
95 0.2
96 0.17
97 0.15
98 0.19
99 0.15
100 0.18
101 0.2
102 0.2
103 0.18
104 0.18
105 0.19
106 0.13
107 0.13
108 0.1
109 0.08
110 0.07
111 0.08
112 0.09
113 0.09
114 0.09
115 0.09
116 0.09
117 0.09
118 0.12
119 0.12
120 0.14
121 0.15
122 0.16
123 0.16
124 0.19
125 0.21
126 0.21
127 0.27
128 0.29
129 0.28
130 0.29
131 0.3
132 0.31
133 0.33
134 0.31
135 0.28
136 0.26
137 0.26
138 0.24
139 0.24
140 0.19
141 0.15
142 0.13
143 0.12
144 0.07
145 0.08
146 0.07
147 0.05
148 0.05
149 0.05
150 0.06
151 0.05
152 0.05
153 0.06
154 0.06
155 0.08
156 0.08
157 0.07
158 0.08
159 0.1
160 0.14
161 0.18
162 0.19
163 0.2
164 0.21
165 0.21
166 0.22
167 0.21
168 0.16
169 0.11
170 0.11
171 0.1
172 0.09
173 0.09
174 0.08
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.07
181 0.07
182 0.07
183 0.11
184 0.18
185 0.22
186 0.22
187 0.23
188 0.25
189 0.33
190 0.35
191 0.34
192 0.3
193 0.29
194 0.31
195 0.31
196 0.29
197 0.27
198 0.25
199 0.24
200 0.24
201 0.22
202 0.2
203 0.26
204 0.25
205 0.24
206 0.32
207 0.35
208 0.4
209 0.45
210 0.46
211 0.47
212 0.57
213 0.64
214 0.67
215 0.7
216 0.65
217 0.65
218 0.68
219 0.65
220 0.59
221 0.56
222 0.49
223 0.41
224 0.4
225 0.36
226 0.32
227 0.27
228 0.22
229 0.17
230 0.17
231 0.18
232 0.22
233 0.27
234 0.34
235 0.43
236 0.49
237 0.56
238 0.62
239 0.69
240 0.7
241 0.76
242 0.78
243 0.8
244 0.82
245 0.81
246 0.83
247 0.84
248 0.84
249 0.83
250 0.84
251 0.84
252 0.84
253 0.81
254 0.8
255 0.74
256 0.69
257 0.61
258 0.51
259 0.4
260 0.31
261 0.25
262 0.15
263 0.11
264 0.09
265 0.07
266 0.06
267 0.05
268 0.05
269 0.08
270 0.1
271 0.15
272 0.19
273 0.2
274 0.23
275 0.29
276 0.31
277 0.37
278 0.43
279 0.45
280 0.44
281 0.46
282 0.46