Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3DAC6

Protein Details
Accession M3DAC6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-49AAKKHVPIVKKHTKRFNRHQSDRFMRVDPSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
12-18KKHTKRF
31-49PSWRKPKGIDNRVRRRFKG
Subcellular Location(s) mito 17, cyto 6.5, cyto_nucl 5.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHTKRFNRHQSDRFMRVDPSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNIKTRHMMPSGHKAFLVNNTRDLDLLLMHNKTYAAEIAHAVSSRKRIEIVARAKQLGVKVTNGKAKITTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.84
4 0.87
5 0.89
6 0.88
7 0.89
8 0.87
9 0.87
10 0.85
11 0.82
12 0.74
13 0.65
14 0.56
15 0.49
16 0.51
17 0.48
18 0.49
19 0.52
20 0.5
21 0.5
22 0.5
23 0.57
24 0.58
25 0.61
26 0.62
27 0.63
28 0.73
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.29
44 0.24
45 0.16
46 0.14
47 0.2
48 0.21
49 0.21
50 0.23
51 0.23
52 0.25
53 0.25
54 0.25
55 0.2
56 0.29
57 0.31
58 0.3
59 0.29
60 0.26
61 0.25
62 0.3
63 0.34
64 0.24
65 0.25
66 0.26
67 0.26
68 0.26
69 0.25
70 0.18
71 0.11
72 0.13
73 0.12
74 0.11
75 0.1
76 0.11
77 0.11
78 0.11
79 0.11
80 0.1
81 0.07
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.11
88 0.12
89 0.17
90 0.17
91 0.18
92 0.18
93 0.18
94 0.24
95 0.32
96 0.39
97 0.42
98 0.45
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37