Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B3X7

Protein Details
Accession M3B3X7   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
86-108ARQVTSRATNKIRKKPAKLKPCFHydrophilic
NLS Segment(s)
PositionSequence
96-103KIRKKPAK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MALTNDTPRVPLRRSLPSRLKGSLTETIYNPLLIQRISFTNRLQAPQNSVVPGFPILAPVLEEVRSPEDRELVESISAVPSRSNAARQVTSRATNKIRKKPAKLKPCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.61
4 0.63
5 0.66
6 0.62
7 0.59
8 0.5
9 0.5
10 0.47
11 0.41
12 0.36
13 0.32
14 0.32
15 0.3
16 0.28
17 0.23
18 0.17
19 0.15
20 0.12
21 0.11
22 0.09
23 0.12
24 0.15
25 0.18
26 0.17
27 0.22
28 0.23
29 0.25
30 0.27
31 0.25
32 0.27
33 0.28
34 0.28
35 0.23
36 0.21
37 0.19
38 0.16
39 0.15
40 0.11
41 0.07
42 0.06
43 0.06
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.1
52 0.11
53 0.12
54 0.12
55 0.13
56 0.13
57 0.16
58 0.15
59 0.12
60 0.12
61 0.11
62 0.11
63 0.11
64 0.11
65 0.09
66 0.08
67 0.08
68 0.12
69 0.13
70 0.15
71 0.18
72 0.22
73 0.26
74 0.27
75 0.33
76 0.35
77 0.4
78 0.42
79 0.44
80 0.48
81 0.54
82 0.62
83 0.66
84 0.72
85 0.75
86 0.82
87 0.85
88 0.87