Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3DEJ0

Protein Details
Accession M3DEJ0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-74ILETPSLRQRSRRRQRRRRNSSSNAIVRHydrophilic
NLS Segment(s)
PositionSequence
55-65QRSRRRQRRRR
Subcellular Location(s) plas 18, mito 3, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences LILGIIALVLPPIPVIIRRGCSGHVLLNIFLCILGWIPGVVHAWYIILETPSLRQRSRRRQRRRRNSSSNAIVREEIYIPPRQGYVRSSRSRSRSRTRSRSSVGRIAAAPAPVVDVYGGSRVPYYREEVYAYDGRGGYAPPPRVKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.1
3 0.14
4 0.16
5 0.18
6 0.2
7 0.21
8 0.24
9 0.24
10 0.25
11 0.25
12 0.24
13 0.22
14 0.21
15 0.2
16 0.16
17 0.14
18 0.1
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.06
37 0.09
38 0.14
39 0.17
40 0.18
41 0.26
42 0.35
43 0.47
44 0.58
45 0.66
46 0.72
47 0.8
48 0.91
49 0.94
50 0.94
51 0.94
52 0.93
53 0.89
54 0.86
55 0.84
56 0.78
57 0.69
58 0.59
59 0.49
60 0.39
61 0.32
62 0.25
63 0.17
64 0.14
65 0.13
66 0.12
67 0.13
68 0.13
69 0.12
70 0.13
71 0.15
72 0.21
73 0.27
74 0.32
75 0.37
76 0.42
77 0.5
78 0.56
79 0.61
80 0.64
81 0.66
82 0.71
83 0.77
84 0.77
85 0.78
86 0.75
87 0.75
88 0.71
89 0.68
90 0.58
91 0.5
92 0.43
93 0.38
94 0.34
95 0.26
96 0.19
97 0.12
98 0.12
99 0.1
100 0.09
101 0.07
102 0.05
103 0.06
104 0.08
105 0.08
106 0.07
107 0.08
108 0.09
109 0.11
110 0.13
111 0.17
112 0.18
113 0.19
114 0.21
115 0.22
116 0.28
117 0.28
118 0.27
119 0.26
120 0.24
121 0.23
122 0.21
123 0.21
124 0.19
125 0.23
126 0.29