Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B6Z6

Protein Details
Accession M3B6Z6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-100YKLKWKWKYLGRKGWNDVRSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, pero 6.5, mito_nucl 6.5, cyto_pero 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MIVYAPQTAFGTVDNLKVPHLPKPAATVLGYFERNCNLLDLWALPPRGANAILRGIRDPCDYGGISQLVLAALDMDMDMVYKLKWKWKYLGRKGWNDVRSAPRPMRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.19
5 0.2
6 0.23
7 0.27
8 0.26
9 0.24
10 0.29
11 0.3
12 0.29
13 0.28
14 0.22
15 0.19
16 0.23
17 0.23
18 0.18
19 0.18
20 0.16
21 0.17
22 0.16
23 0.15
24 0.11
25 0.09
26 0.1
27 0.1
28 0.11
29 0.14
30 0.13
31 0.12
32 0.12
33 0.12
34 0.13
35 0.12
36 0.1
37 0.08
38 0.13
39 0.14
40 0.15
41 0.15
42 0.14
43 0.15
44 0.16
45 0.15
46 0.1
47 0.12
48 0.12
49 0.11
50 0.13
51 0.11
52 0.1
53 0.09
54 0.09
55 0.06
56 0.06
57 0.06
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.08
69 0.1
70 0.18
71 0.23
72 0.27
73 0.35
74 0.44
75 0.55
76 0.61
77 0.71
78 0.72
79 0.76
80 0.8
81 0.81
82 0.75
83 0.67
84 0.64
85 0.62
86 0.59
87 0.58