Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2QZ80

Protein Details
Accession M2QZ80    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-88FPGAGFKRRASKRRRSMERIRDEEYBasic
NLS Segment(s)
PositionSequence
69-79FKRRASKRRRS
Subcellular Location(s) mito 16, cyto 7, nucl 3
Family & Domain DBs
Amino Acid Sequences MTLTRSRLVASIVLKVSHGHNVRDVYDPVLTLAYQAASDFSAATTPGAYFVDVLHILRYILRWFPGAGFKRRASKRRRSMERIRDEEYEVIEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.25
5 0.26
6 0.21
7 0.25
8 0.26
9 0.28
10 0.3
11 0.29
12 0.23
13 0.21
14 0.19
15 0.15
16 0.14
17 0.12
18 0.08
19 0.08
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.06
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.08
46 0.07
47 0.08
48 0.09
49 0.09
50 0.09
51 0.11
52 0.2
53 0.24
54 0.28
55 0.33
56 0.36
57 0.45
58 0.53
59 0.61
60 0.61
61 0.67
62 0.72
63 0.77
64 0.83
65 0.83
66 0.86
67 0.88
68 0.89
69 0.85
70 0.79
71 0.71
72 0.64
73 0.57