Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2R7M7

Protein Details
Accession M2R7M7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MLLDCKGKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLLDCKGKQCRKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQLSLKRCKHFELGGEKKTKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.88
4 0.9
5 0.86
6 0.88
7 0.87
8 0.83
9 0.77
10 0.72
11 0.63
12 0.56
13 0.54
14 0.53
15 0.53
16 0.51
17 0.51
18 0.52
19 0.55
20 0.58
21 0.59
22 0.55
23 0.55
24 0.59
25 0.61
26 0.63
27 0.61
28 0.6
29 0.59
30 0.61
31 0.52
32 0.47
33 0.43
34 0.35
35 0.37
36 0.37
37 0.36
38 0.3
39 0.36
40 0.4
41 0.49
42 0.57
43 0.6
44 0.59
45 0.63
46 0.7
47 0.71
48 0.69
49 0.66
50 0.61
51 0.58
52 0.56
53 0.51
54 0.46
55 0.43
56 0.38
57 0.32
58 0.3
59 0.29
60 0.34
61 0.4
62 0.44
63 0.47
64 0.56
65 0.64
66 0.69
67 0.66
68 0.61
69 0.58
70 0.53
71 0.52
72 0.52
73 0.53
74 0.53
75 0.57
76 0.53
77 0.5
78 0.48
79 0.42