Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2R2U2

Protein Details
Accession M2R2U2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-40AHAGGDWRGRKRRRAPPEVYEWFKBasic
NLS Segment(s)
PositionSequence
24-31RGRKRRRA
Subcellular Location(s) nucl 9.5, pero 8, cyto_nucl 7.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPKSQLRTTSQDGTKIAHAGGDWRGRKRRRAPPEVYEWFKNVFDANPNASIRDLVKVAHTYGPDAQFMTYKSVSNMFEKKRKRGCSLSSAELRTRIQELLHTNPDPSFRMVCSWAISLGAAQATVFREVARAQDELIQQGALAASPEKAGHPRTLSGPPVAAACADGHLLASDGGHRREIPMSVSGQERWTDITIDAIEAEGGAAGPYLLEHWRGADPIVQPPSSFQYAWGAHNAQTEDYVPLPDSIGSAWWPTITGDFDPPPTASGCQLNPDPAHLPTWTKYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.32
4 0.23
5 0.2
6 0.18
7 0.23
8 0.29
9 0.31
10 0.38
11 0.48
12 0.53
13 0.63
14 0.7
15 0.74
16 0.76
17 0.81
18 0.81
19 0.79
20 0.83
21 0.82
22 0.78
23 0.7
24 0.62
25 0.55
26 0.47
27 0.4
28 0.31
29 0.24
30 0.23
31 0.24
32 0.24
33 0.27
34 0.27
35 0.27
36 0.26
37 0.26
38 0.21
39 0.2
40 0.18
41 0.12
42 0.15
43 0.16
44 0.17
45 0.19
46 0.18
47 0.18
48 0.22
49 0.23
50 0.21
51 0.2
52 0.18
53 0.17
54 0.18
55 0.21
56 0.17
57 0.16
58 0.17
59 0.2
60 0.22
61 0.25
62 0.32
63 0.33
64 0.41
65 0.47
66 0.55
67 0.6
68 0.64
69 0.65
70 0.65
71 0.64
72 0.65
73 0.64
74 0.61
75 0.59
76 0.56
77 0.5
78 0.46
79 0.41
80 0.33
81 0.29
82 0.22
83 0.17
84 0.18
85 0.21
86 0.23
87 0.27
88 0.26
89 0.25
90 0.25
91 0.27
92 0.24
93 0.22
94 0.17
95 0.13
96 0.14
97 0.15
98 0.15
99 0.15
100 0.13
101 0.12
102 0.11
103 0.1
104 0.08
105 0.07
106 0.06
107 0.04
108 0.04
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.09
117 0.1
118 0.09
119 0.08
120 0.13
121 0.13
122 0.13
123 0.13
124 0.11
125 0.09
126 0.09
127 0.08
128 0.04
129 0.04
130 0.03
131 0.03
132 0.04
133 0.04
134 0.05
135 0.07
136 0.09
137 0.11
138 0.12
139 0.13
140 0.16
141 0.18
142 0.19
143 0.17
144 0.16
145 0.15
146 0.14
147 0.13
148 0.09
149 0.07
150 0.06
151 0.05
152 0.05
153 0.05
154 0.04
155 0.04
156 0.05
157 0.04
158 0.04
159 0.07
160 0.09
161 0.1
162 0.11
163 0.11
164 0.12
165 0.13
166 0.14
167 0.13
168 0.13
169 0.13
170 0.14
171 0.16
172 0.16
173 0.16
174 0.16
175 0.15
176 0.14
177 0.14
178 0.13
179 0.11
180 0.12
181 0.11
182 0.1
183 0.1
184 0.08
185 0.07
186 0.05
187 0.05
188 0.03
189 0.03
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.04
196 0.05
197 0.06
198 0.06
199 0.08
200 0.09
201 0.1
202 0.11
203 0.13
204 0.14
205 0.2
206 0.24
207 0.22
208 0.21
209 0.23
210 0.27
211 0.26
212 0.24
213 0.18
214 0.22
215 0.25
216 0.26
217 0.29
218 0.25
219 0.24
220 0.28
221 0.28
222 0.21
223 0.2
224 0.19
225 0.17
226 0.16
227 0.15
228 0.12
229 0.12
230 0.12
231 0.11
232 0.1
233 0.09
234 0.09
235 0.09
236 0.09
237 0.09
238 0.09
239 0.09
240 0.09
241 0.11
242 0.13
243 0.13
244 0.17
245 0.18
246 0.2
247 0.21
248 0.21
249 0.21
250 0.2
251 0.19
252 0.18
253 0.21
254 0.21
255 0.24
256 0.26
257 0.3
258 0.28
259 0.31
260 0.31
261 0.28
262 0.29
263 0.25
264 0.28