Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D109

Protein Details
Accession B0D109    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
217-239DKCGKTFSRSHDRKRHHETQHLABasic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
KEGG lbc:LACBIDRAFT_324193  -  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MQHSHRDHPYDDQGNSYPTGHVVSHHSDYPISPSYPNYDTQSQYYNAPQPQSIQEANNPYYRSMTPAHSPPHRYLTTAGRDPRYYNPQGVVSSSSAVPSSVYAPQSQYYNASYPPVDHRSPASPPPQSHFIPTPSEIAHSYSNYTHHMSIPRSPTVPPPENYRSPSLDYHASSHIPSQHSHSHRPRVMTGRPRTVSSAASTSPISASSPSGERFPCDKCGKTFSRSHDRKRHHETQHLASPVIHRCRFCEKEFSRWHISVLALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.34
4 0.25
5 0.19
6 0.21
7 0.16
8 0.16
9 0.19
10 0.23
11 0.25
12 0.26
13 0.26
14 0.24
15 0.24
16 0.28
17 0.27
18 0.23
19 0.21
20 0.21
21 0.25
22 0.27
23 0.29
24 0.29
25 0.3
26 0.31
27 0.32
28 0.34
29 0.3
30 0.31
31 0.32
32 0.34
33 0.32
34 0.32
35 0.3
36 0.28
37 0.3
38 0.32
39 0.3
40 0.25
41 0.27
42 0.32
43 0.34
44 0.35
45 0.33
46 0.29
47 0.3
48 0.28
49 0.26
50 0.23
51 0.23
52 0.24
53 0.28
54 0.34
55 0.37
56 0.4
57 0.4
58 0.45
59 0.42
60 0.39
61 0.37
62 0.38
63 0.39
64 0.42
65 0.43
66 0.39
67 0.4
68 0.41
69 0.44
70 0.44
71 0.4
72 0.35
73 0.32
74 0.32
75 0.31
76 0.29
77 0.26
78 0.18
79 0.17
80 0.15
81 0.13
82 0.11
83 0.1
84 0.09
85 0.07
86 0.08
87 0.1
88 0.11
89 0.11
90 0.12
91 0.13
92 0.14
93 0.14
94 0.14
95 0.13
96 0.13
97 0.13
98 0.13
99 0.13
100 0.13
101 0.18
102 0.21
103 0.19
104 0.19
105 0.2
106 0.21
107 0.24
108 0.27
109 0.27
110 0.26
111 0.27
112 0.3
113 0.33
114 0.31
115 0.31
116 0.29
117 0.25
118 0.24
119 0.24
120 0.22
121 0.17
122 0.18
123 0.15
124 0.16
125 0.15
126 0.13
127 0.13
128 0.12
129 0.14
130 0.15
131 0.16
132 0.14
133 0.15
134 0.19
135 0.19
136 0.23
137 0.25
138 0.25
139 0.24
140 0.24
141 0.27
142 0.31
143 0.35
144 0.31
145 0.35
146 0.39
147 0.42
148 0.45
149 0.43
150 0.37
151 0.36
152 0.36
153 0.31
154 0.29
155 0.26
156 0.26
157 0.24
158 0.23
159 0.2
160 0.21
161 0.22
162 0.2
163 0.19
164 0.22
165 0.28
166 0.32
167 0.41
168 0.46
169 0.51
170 0.52
171 0.55
172 0.55
173 0.53
174 0.57
175 0.58
176 0.58
177 0.57
178 0.56
179 0.55
180 0.53
181 0.48
182 0.42
183 0.35
184 0.3
185 0.21
186 0.22
187 0.2
188 0.17
189 0.15
190 0.14
191 0.12
192 0.1
193 0.11
194 0.11
195 0.13
196 0.14
197 0.18
198 0.17
199 0.2
200 0.23
201 0.25
202 0.32
203 0.34
204 0.37
205 0.37
206 0.45
207 0.46
208 0.48
209 0.52
210 0.52
211 0.58
212 0.63
213 0.7
214 0.72
215 0.76
216 0.8
217 0.83
218 0.84
219 0.81
220 0.81
221 0.78
222 0.76
223 0.76
224 0.68
225 0.6
226 0.51
227 0.49
228 0.48
229 0.5
230 0.46
231 0.38
232 0.41
233 0.5
234 0.54
235 0.51
236 0.54
237 0.48
238 0.55
239 0.63
240 0.66
241 0.64
242 0.59
243 0.57
244 0.49