Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2R325

Protein Details
Accession M2R325    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
195-222YQQPDKRKLSKSAKARLKKKLKMESAADHydrophilic
NLS Segment(s)
PositionSequence
200-216KRKLSKSAKARLKKKLK
Subcellular Location(s) nucl 19, cyto_nucl 11.833, mito_nucl 11.833, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAGELSQAHEIRITGHGKIEAWVAFALRFFQVGCHDTRTLSTNAHSDDNQENESKPLTLHTLPAKKAQTDTGTENTRTDAEPPVPETQELPEPNTEKSRMAPSMSTIPRLVSVVEIIKREYLKSLDPELAESGSLSGLHQYNEVGELEDDQANGEDALVAMLSGKRHLRQHKVAYMKVTLCRQELPHLVAAGATYQQPDKRKLSKSAKARLKKKLKMESAADSAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.21
4 0.21
5 0.22
6 0.23
7 0.17
8 0.17
9 0.16
10 0.14
11 0.13
12 0.12
13 0.13
14 0.1
15 0.1
16 0.08
17 0.1
18 0.14
19 0.15
20 0.17
21 0.2
22 0.21
23 0.21
24 0.23
25 0.25
26 0.22
27 0.22
28 0.22
29 0.21
30 0.23
31 0.26
32 0.24
33 0.24
34 0.26
35 0.27
36 0.27
37 0.24
38 0.22
39 0.21
40 0.22
41 0.18
42 0.14
43 0.13
44 0.15
45 0.14
46 0.18
47 0.24
48 0.29
49 0.3
50 0.37
51 0.38
52 0.35
53 0.35
54 0.35
55 0.3
56 0.28
57 0.3
58 0.29
59 0.31
60 0.31
61 0.3
62 0.27
63 0.25
64 0.22
65 0.2
66 0.17
67 0.15
68 0.15
69 0.17
70 0.19
71 0.18
72 0.18
73 0.17
74 0.16
75 0.2
76 0.19
77 0.18
78 0.19
79 0.19
80 0.21
81 0.23
82 0.23
83 0.18
84 0.19
85 0.21
86 0.19
87 0.19
88 0.17
89 0.16
90 0.24
91 0.24
92 0.24
93 0.2
94 0.19
95 0.18
96 0.18
97 0.16
98 0.08
99 0.08
100 0.08
101 0.1
102 0.1
103 0.1
104 0.12
105 0.12
106 0.12
107 0.12
108 0.12
109 0.12
110 0.14
111 0.16
112 0.16
113 0.16
114 0.16
115 0.15
116 0.14
117 0.12
118 0.09
119 0.07
120 0.05
121 0.05
122 0.04
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.09
131 0.07
132 0.06
133 0.07
134 0.09
135 0.09
136 0.09
137 0.08
138 0.08
139 0.07
140 0.07
141 0.06
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.05
149 0.05
150 0.08
151 0.1
152 0.14
153 0.21
154 0.29
155 0.37
156 0.44
157 0.52
158 0.57
159 0.62
160 0.61
161 0.58
162 0.56
163 0.51
164 0.47
165 0.44
166 0.39
167 0.34
168 0.34
169 0.32
170 0.33
171 0.34
172 0.32
173 0.3
174 0.27
175 0.26
176 0.23
177 0.21
178 0.16
179 0.13
180 0.1
181 0.09
182 0.12
183 0.16
184 0.21
185 0.27
186 0.34
187 0.41
188 0.47
189 0.56
190 0.63
191 0.67
192 0.73
193 0.77
194 0.8
195 0.82
196 0.85
197 0.85
198 0.86
199 0.85
200 0.85
201 0.85
202 0.83
203 0.81
204 0.78
205 0.74
206 0.68