Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DVH2

Protein Details
Accession B0DVH2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
117-148LVGSPASVRKKNKNKKKKKTKRADENGKVFVCHydrophilic
NLS Segment(s)
PositionSequence
125-138RKKNKNKKKKKTKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG lbc:LACBIDRAFT_310985  -  
Amino Acid Sequences MRESSPLSIQSQDMELSFQVSVAGVRISNFDPAKTSSSEAVARYISDVEKKNDLEEGTLRDAIIASTPFGTRLWETTKTGSFVPQPAPLNMRLEDAFGNEGGTYLLEVKPEFLKYFLVGSPASVRKKNKNKKKKKTKRADENGKVFVCIFEVSRIYHFQLTNLRQTLLKSQLTLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.12
5 0.1
6 0.09
7 0.08
8 0.08
9 0.07
10 0.08
11 0.06
12 0.07
13 0.09
14 0.1
15 0.17
16 0.17
17 0.17
18 0.19
19 0.21
20 0.23
21 0.23
22 0.24
23 0.18
24 0.21
25 0.23
26 0.21
27 0.21
28 0.18
29 0.17
30 0.15
31 0.16
32 0.14
33 0.17
34 0.2
35 0.21
36 0.25
37 0.25
38 0.25
39 0.26
40 0.25
41 0.21
42 0.19
43 0.2
44 0.18
45 0.18
46 0.17
47 0.15
48 0.15
49 0.13
50 0.12
51 0.08
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.09
58 0.08
59 0.1
60 0.14
61 0.16
62 0.17
63 0.19
64 0.2
65 0.2
66 0.2
67 0.2
68 0.17
69 0.16
70 0.17
71 0.19
72 0.19
73 0.18
74 0.2
75 0.19
76 0.2
77 0.18
78 0.18
79 0.13
80 0.13
81 0.12
82 0.11
83 0.11
84 0.08
85 0.08
86 0.06
87 0.06
88 0.05
89 0.05
90 0.04
91 0.05
92 0.05
93 0.06
94 0.06
95 0.07
96 0.08
97 0.1
98 0.1
99 0.09
100 0.1
101 0.1
102 0.12
103 0.11
104 0.12
105 0.11
106 0.11
107 0.16
108 0.21
109 0.24
110 0.28
111 0.33
112 0.41
113 0.53
114 0.63
115 0.69
116 0.74
117 0.82
118 0.88
119 0.94
120 0.95
121 0.95
122 0.96
123 0.96
124 0.96
125 0.96
126 0.96
127 0.94
128 0.9
129 0.87
130 0.75
131 0.65
132 0.54
133 0.42
134 0.33
135 0.23
136 0.17
137 0.12
138 0.13
139 0.14
140 0.17
141 0.19
142 0.21
143 0.25
144 0.24
145 0.25
146 0.33
147 0.35
148 0.41
149 0.4
150 0.39
151 0.35
152 0.37
153 0.41
154 0.39
155 0.37
156 0.29