Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QYW4

Protein Details
Accession M2QYW4   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-119TVPAPSKRLKARRCTMRRGRRTPSRNCHydrophilic
NLS Segment(s)
PositionSequence
102-104KAR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSFRESLALRSKRFSLSPPTLLPSSDLPPRSDETSTSSPTSPARASWERHHRCASNGSARVVAHDIPTYPTSALPRTAAASASFSGAAWHHVTVPAPSKRLKARRCTMRRGRRTPSRNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.39
4 0.42
5 0.41
6 0.42
7 0.39
8 0.38
9 0.36
10 0.29
11 0.26
12 0.27
13 0.26
14 0.23
15 0.25
16 0.28
17 0.28
18 0.26
19 0.24
20 0.25
21 0.28
22 0.29
23 0.29
24 0.26
25 0.25
26 0.25
27 0.27
28 0.2
29 0.16
30 0.21
31 0.23
32 0.26
33 0.33
34 0.44
35 0.45
36 0.49
37 0.53
38 0.46
39 0.44
40 0.45
41 0.41
42 0.38
43 0.36
44 0.32
45 0.3
46 0.29
47 0.28
48 0.25
49 0.2
50 0.12
51 0.1
52 0.1
53 0.1
54 0.11
55 0.1
56 0.09
57 0.1
58 0.11
59 0.12
60 0.13
61 0.12
62 0.12
63 0.13
64 0.13
65 0.12
66 0.11
67 0.12
68 0.11
69 0.11
70 0.1
71 0.09
72 0.09
73 0.09
74 0.11
75 0.1
76 0.1
77 0.1
78 0.11
79 0.12
80 0.13
81 0.21
82 0.23
83 0.24
84 0.27
85 0.32
86 0.41
87 0.5
88 0.55
89 0.57
90 0.64
91 0.72
92 0.78
93 0.83
94 0.85
95 0.86
96 0.89
97 0.88
98 0.88
99 0.88