Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QNV4

Protein Details
Accession M2QNV4   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-148PDKAREKEERKRRKAERKEEKRLKKAARRBasic
NLS Segment(s)
PositionSequence
122-157KAREKEERKRRKAERKEEKRLKKAARRARRGGRGAE
167-200RDSGRRDGRRGERDWSRERRERTPPPSARGADAG
205-210RERERE
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MYEPVRGGTRGGQAEFKWSDVSADKDREHYLGHSINAPTGRWQKNKDVHWYARDKDEDQAARDEEIRRIKEAEAEALAAALGFASGSKPGVPGAPSAPGTGANAIGVAPKPTLDTDALDPDKAREKEERKRRKAERKEEKRLKKAARRARRGGRGAESGEDSADGDRDSGRRDGRRGERDWSRERRERTPPPSARGADAGGYGQRERERERERDRRSVSLETPGVALWQRVATLELGRASSGRWVIQLRRRAPVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.32
4 0.26
5 0.22
6 0.24
7 0.23
8 0.29
9 0.27
10 0.32
11 0.32
12 0.34
13 0.36
14 0.34
15 0.33
16 0.28
17 0.28
18 0.25
19 0.25
20 0.27
21 0.25
22 0.27
23 0.27
24 0.26
25 0.27
26 0.33
27 0.39
28 0.41
29 0.45
30 0.52
31 0.58
32 0.64
33 0.66
34 0.66
35 0.64
36 0.66
37 0.68
38 0.61
39 0.6
40 0.58
41 0.5
42 0.44
43 0.45
44 0.4
45 0.35
46 0.37
47 0.31
48 0.28
49 0.3
50 0.29
51 0.27
52 0.31
53 0.3
54 0.28
55 0.29
56 0.28
57 0.29
58 0.28
59 0.25
60 0.18
61 0.17
62 0.15
63 0.13
64 0.12
65 0.07
66 0.06
67 0.03
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.06
78 0.07
79 0.08
80 0.09
81 0.11
82 0.12
83 0.12
84 0.12
85 0.11
86 0.11
87 0.1
88 0.09
89 0.06
90 0.05
91 0.05
92 0.06
93 0.05
94 0.06
95 0.05
96 0.05
97 0.06
98 0.06
99 0.08
100 0.08
101 0.09
102 0.09
103 0.15
104 0.15
105 0.15
106 0.15
107 0.14
108 0.21
109 0.2
110 0.21
111 0.23
112 0.29
113 0.38
114 0.49
115 0.59
116 0.58
117 0.68
118 0.75
119 0.79
120 0.83
121 0.85
122 0.86
123 0.86
124 0.9
125 0.9
126 0.9
127 0.87
128 0.85
129 0.83
130 0.8
131 0.79
132 0.78
133 0.78
134 0.77
135 0.78
136 0.78
137 0.79
138 0.74
139 0.69
140 0.63
141 0.56
142 0.48
143 0.41
144 0.33
145 0.24
146 0.2
147 0.16
148 0.12
149 0.08
150 0.08
151 0.06
152 0.05
153 0.06
154 0.07
155 0.09
156 0.13
157 0.18
158 0.21
159 0.23
160 0.31
161 0.4
162 0.46
163 0.47
164 0.5
165 0.53
166 0.57
167 0.64
168 0.65
169 0.65
170 0.65
171 0.68
172 0.68
173 0.7
174 0.72
175 0.7
176 0.72
177 0.69
178 0.66
179 0.69
180 0.62
181 0.54
182 0.46
183 0.4
184 0.3
185 0.25
186 0.21
187 0.14
188 0.15
189 0.13
190 0.15
191 0.16
192 0.19
193 0.22
194 0.31
195 0.36
196 0.44
197 0.54
198 0.62
199 0.66
200 0.73
201 0.73
202 0.7
203 0.69
204 0.65
205 0.57
206 0.55
207 0.49
208 0.4
209 0.36
210 0.29
211 0.26
212 0.2
213 0.18
214 0.11
215 0.11
216 0.1
217 0.1
218 0.11
219 0.11
220 0.12
221 0.14
222 0.14
223 0.15
224 0.15
225 0.14
226 0.14
227 0.17
228 0.18
229 0.15
230 0.18
231 0.22
232 0.3
233 0.38
234 0.47
235 0.46