Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D9D3

Protein Details
Accession B0D9D3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-42CFDWNYRCGRKGRRRHHRQEVLFQCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 5, E.R. 5, cyto_mito 5, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG lbc:LACBIDRAFT_296662  -  
Amino Acid Sequences MIGDVWVMECAIYVLVSCFDWNYRCGRKGRRRHHRQEVLFQCVVLVPLQFVWWMKSYVVESLGLSSPIPLLVVKLAEEWLSPEGHPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.07
6 0.09
7 0.1
8 0.12
9 0.18
10 0.23
11 0.28
12 0.34
13 0.45
14 0.53
15 0.62
16 0.72
17 0.76
18 0.82
19 0.87
20 0.91
21 0.9
22 0.84
23 0.84
24 0.78
25 0.74
26 0.63
27 0.52
28 0.41
29 0.31
30 0.27
31 0.17
32 0.11
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.06
39 0.07
40 0.09
41 0.08
42 0.1
43 0.11
44 0.11
45 0.12
46 0.11
47 0.1
48 0.11
49 0.12
50 0.11
51 0.1
52 0.09
53 0.08
54 0.07
55 0.08
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.11
66 0.11
67 0.12