Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2R975

Protein Details
Accession M2R975    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
245-266GIKIRIRKDIRVRKRPTQPLEPBasic
NLS Segment(s)
PositionSequence
307-391REMREREWERERGREREREREREGESERERERERDRERERERDRERERERDRERDRERTRVRERGRERDREGRKDGSPRRPPRRE
Subcellular Location(s) mito 17, extr 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR021740  Velvet  
IPR037525  Velvet_dom  
IPR038491  Velvet_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF11754  Velvet  
PROSITE View protein in PROSITE  
PS51821  VELVET  
Amino Acid Sequences MRVDASIRPYHRSYRLVLYMRLLVAVPSSAHRHAGSLAPLNLLPIYPPLRQPPGSISQGLRDLRGRLRSALVRRAGSVSQADPDRRPIDPPPIVQLRVIDPSVRRPQSSSSRASSPDPPALSSSSFLQNPYYFMFASLAKPDEDVELHWLKDGRTRCTTGSVVSSLYHLKDAEHANEDAGFFVFPDLSVRTEGSYRLKLSLFEVVGSNVYHCKSIFSAPFYVYTAKKFPGMEESTPLSCSLADQGIKIRIRKDIRVRKRPTQPLEPLPTPLPLTGPVPVPLATPAVGAFGPVPIPLDAEAEAREREREMREREWERERGREREREREREGESERERERERDRERERERDRERERERDRERDRERTRVRERGRERDREGRKDGSPRRPPRRESSASDSESMPRRDSFKRQRTEGENDSELNGPGPAPAQAQPQWAIDPALAAPQPPPPTDTHTHYIPPPAAPGSGPAAAPYDHRFSAPAPAQYHYEPHPHAHHPPPPSHPHPYAQPPPPPPPSTHHYNHVPPPPYGHPSYAPPPPAPGPGPAPGTAPPAWTPQQHDPYAQYHHHHYAQPPPPPPSHHVSHGRYPEYSAPPPAAPVPAPANAYAAAPAPQGYAYYEHHPPPPPPTHTHHSYAQHPQAQQHHQHGGYGPPSPGPSGAYGEYPAAVYGAPGGAAPGGARGAPGPAPGPPPAQAGPPDDPQGRVRAYSSSGPTSAGPGAAPSAPGPGAGAYTHAYPPPPPPYAQGPNGSQNQNQPPPPAGQQGQARHYQLSTPPQQHTHAGGGYAYPPLPPQHQGAPAPQGAAESHGAWAPGQGYAVSGAPWGSAPMVHQQPPPTHAQQQQEAYGVGYSRGVQLAPLRAVSPPPSVGAGGERGISKKNPLSIGNIISEDTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.55
4 0.53
5 0.49
6 0.46
7 0.43
8 0.39
9 0.3
10 0.21
11 0.17
12 0.16
13 0.13
14 0.13
15 0.17
16 0.18
17 0.21
18 0.21
19 0.21
20 0.22
21 0.25
22 0.27
23 0.29
24 0.28
25 0.27
26 0.27
27 0.26
28 0.25
29 0.2
30 0.16
31 0.15
32 0.19
33 0.19
34 0.23
35 0.28
36 0.35
37 0.36
38 0.38
39 0.38
40 0.42
41 0.43
42 0.43
43 0.38
44 0.36
45 0.43
46 0.42
47 0.38
48 0.34
49 0.35
50 0.37
51 0.43
52 0.4
53 0.35
54 0.41
55 0.45
56 0.49
57 0.53
58 0.53
59 0.47
60 0.47
61 0.48
62 0.42
63 0.38
64 0.34
65 0.27
66 0.27
67 0.31
68 0.32
69 0.3
70 0.37
71 0.36
72 0.34
73 0.36
74 0.35
75 0.4
76 0.41
77 0.41
78 0.43
79 0.46
80 0.46
81 0.43
82 0.41
83 0.34
84 0.33
85 0.32
86 0.28
87 0.24
88 0.32
89 0.41
90 0.41
91 0.39
92 0.37
93 0.44
94 0.51
95 0.56
96 0.53
97 0.47
98 0.49
99 0.51
100 0.53
101 0.52
102 0.47
103 0.47
104 0.42
105 0.38
106 0.36
107 0.35
108 0.32
109 0.27
110 0.25
111 0.23
112 0.23
113 0.23
114 0.25
115 0.23
116 0.24
117 0.24
118 0.23
119 0.18
120 0.18
121 0.19
122 0.16
123 0.17
124 0.18
125 0.18
126 0.16
127 0.16
128 0.16
129 0.16
130 0.15
131 0.14
132 0.17
133 0.18
134 0.18
135 0.2
136 0.21
137 0.19
138 0.24
139 0.28
140 0.28
141 0.31
142 0.34
143 0.33
144 0.37
145 0.38
146 0.34
147 0.33
148 0.28
149 0.23
150 0.21
151 0.21
152 0.18
153 0.18
154 0.18
155 0.14
156 0.13
157 0.17
158 0.2
159 0.21
160 0.23
161 0.22
162 0.21
163 0.21
164 0.21
165 0.17
166 0.14
167 0.1
168 0.07
169 0.07
170 0.06
171 0.05
172 0.07
173 0.08
174 0.09
175 0.11
176 0.11
177 0.12
178 0.13
179 0.17
180 0.2
181 0.23
182 0.23
183 0.24
184 0.25
185 0.24
186 0.25
187 0.28
188 0.22
189 0.19
190 0.18
191 0.16
192 0.17
193 0.16
194 0.15
195 0.12
196 0.12
197 0.12
198 0.12
199 0.13
200 0.13
201 0.18
202 0.2
203 0.21
204 0.23
205 0.23
206 0.25
207 0.25
208 0.27
209 0.23
210 0.23
211 0.23
212 0.21
213 0.24
214 0.22
215 0.22
216 0.26
217 0.3
218 0.28
219 0.28
220 0.31
221 0.28
222 0.29
223 0.28
224 0.2
225 0.15
226 0.14
227 0.12
228 0.12
229 0.11
230 0.12
231 0.15
232 0.22
233 0.25
234 0.27
235 0.26
236 0.31
237 0.34
238 0.42
239 0.49
240 0.53
241 0.61
242 0.69
243 0.75
244 0.77
245 0.83
246 0.85
247 0.81
248 0.8
249 0.76
250 0.74
251 0.75
252 0.66
253 0.59
254 0.5
255 0.45
256 0.36
257 0.29
258 0.21
259 0.15
260 0.15
261 0.13
262 0.13
263 0.13
264 0.13
265 0.13
266 0.12
267 0.12
268 0.12
269 0.1
270 0.09
271 0.08
272 0.08
273 0.07
274 0.07
275 0.06
276 0.06
277 0.06
278 0.05
279 0.07
280 0.05
281 0.06
282 0.06
283 0.07
284 0.07
285 0.08
286 0.09
287 0.1
288 0.1
289 0.1
290 0.11
291 0.11
292 0.14
293 0.18
294 0.25
295 0.29
296 0.33
297 0.41
298 0.44
299 0.49
300 0.52
301 0.55
302 0.5
303 0.54
304 0.54
305 0.54
306 0.56
307 0.6
308 0.58
309 0.61
310 0.66
311 0.65
312 0.64
313 0.61
314 0.58
315 0.55
316 0.54
317 0.51
318 0.46
319 0.45
320 0.42
321 0.41
322 0.4
323 0.39
324 0.41
325 0.42
326 0.45
327 0.49
328 0.53
329 0.59
330 0.63
331 0.69
332 0.69
333 0.7
334 0.69
335 0.69
336 0.69
337 0.69
338 0.69
339 0.69
340 0.69
341 0.69
342 0.69
343 0.69
344 0.69
345 0.69
346 0.69
347 0.7
348 0.68
349 0.68
350 0.68
351 0.68
352 0.7
353 0.69
354 0.68
355 0.67
356 0.7
357 0.7
358 0.72
359 0.7
360 0.68
361 0.68
362 0.71
363 0.68
364 0.66
365 0.59
366 0.55
367 0.57
368 0.6
369 0.61
370 0.64
371 0.67
372 0.72
373 0.75
374 0.76
375 0.74
376 0.75
377 0.69
378 0.65
379 0.63
380 0.61
381 0.55
382 0.52
383 0.45
384 0.4
385 0.4
386 0.35
387 0.29
388 0.22
389 0.24
390 0.26
391 0.36
392 0.43
393 0.46
394 0.5
395 0.51
396 0.56
397 0.57
398 0.61
399 0.55
400 0.49
401 0.41
402 0.36
403 0.35
404 0.3
405 0.24
406 0.17
407 0.12
408 0.08
409 0.06
410 0.06
411 0.05
412 0.06
413 0.07
414 0.1
415 0.11
416 0.13
417 0.14
418 0.14
419 0.14
420 0.13
421 0.12
422 0.09
423 0.08
424 0.06
425 0.07
426 0.06
427 0.06
428 0.06
429 0.1
430 0.11
431 0.11
432 0.13
433 0.13
434 0.18
435 0.21
436 0.25
437 0.25
438 0.25
439 0.26
440 0.25
441 0.26
442 0.22
443 0.18
444 0.15
445 0.12
446 0.11
447 0.09
448 0.1
449 0.1
450 0.1
451 0.1
452 0.09
453 0.09
454 0.09
455 0.11
456 0.12
457 0.12
458 0.12
459 0.12
460 0.12
461 0.12
462 0.18
463 0.2
464 0.22
465 0.21
466 0.22
467 0.24
468 0.24
469 0.25
470 0.21
471 0.23
472 0.19
473 0.2
474 0.23
475 0.24
476 0.28
477 0.31
478 0.34
479 0.33
480 0.35
481 0.38
482 0.41
483 0.43
484 0.44
485 0.41
486 0.38
487 0.4
488 0.44
489 0.46
490 0.44
491 0.46
492 0.44
493 0.48
494 0.51
495 0.48
496 0.43
497 0.4
498 0.4
499 0.41
500 0.39
501 0.39
502 0.39
503 0.42
504 0.46
505 0.48
506 0.45
507 0.38
508 0.41
509 0.38
510 0.37
511 0.34
512 0.29
513 0.24
514 0.25
515 0.29
516 0.28
517 0.26
518 0.22
519 0.23
520 0.23
521 0.24
522 0.21
523 0.2
524 0.19
525 0.2
526 0.22
527 0.19
528 0.19
529 0.18
530 0.21
531 0.19
532 0.18
533 0.16
534 0.18
535 0.2
536 0.2
537 0.24
538 0.27
539 0.33
540 0.33
541 0.33
542 0.31
543 0.33
544 0.36
545 0.34
546 0.29
547 0.28
548 0.31
549 0.33
550 0.33
551 0.31
552 0.36
553 0.39
554 0.43
555 0.43
556 0.42
557 0.41
558 0.43
559 0.45
560 0.4
561 0.37
562 0.38
563 0.43
564 0.43
565 0.48
566 0.5
567 0.48
568 0.43
569 0.42
570 0.41
571 0.38
572 0.35
573 0.3
574 0.25
575 0.23
576 0.24
577 0.23
578 0.18
579 0.13
580 0.14
581 0.15
582 0.15
583 0.16
584 0.15
585 0.16
586 0.14
587 0.14
588 0.12
589 0.1
590 0.09
591 0.08
592 0.08
593 0.07
594 0.07
595 0.07
596 0.07
597 0.1
598 0.11
599 0.15
600 0.19
601 0.2
602 0.24
603 0.27
604 0.27
605 0.31
606 0.36
607 0.37
608 0.38
609 0.43
610 0.46
611 0.48
612 0.51
613 0.51
614 0.48
615 0.49
616 0.53
617 0.52
618 0.51
619 0.47
620 0.48
621 0.49
622 0.51
623 0.51
624 0.48
625 0.47
626 0.41
627 0.42
628 0.38
629 0.34
630 0.29
631 0.26
632 0.21
633 0.17
634 0.17
635 0.16
636 0.16
637 0.13
638 0.13
639 0.13
640 0.14
641 0.13
642 0.13
643 0.13
644 0.13
645 0.11
646 0.1
647 0.07
648 0.06
649 0.05
650 0.05
651 0.04
652 0.04
653 0.04
654 0.04
655 0.03
656 0.04
657 0.04
658 0.04
659 0.04
660 0.04
661 0.04
662 0.05
663 0.06
664 0.07
665 0.08
666 0.08
667 0.09
668 0.12
669 0.14
670 0.15
671 0.15
672 0.18
673 0.18
674 0.2
675 0.21
676 0.24
677 0.26
678 0.27
679 0.3
680 0.28
681 0.3
682 0.29
683 0.31
684 0.27
685 0.24
686 0.23
687 0.2
688 0.23
689 0.26
690 0.28
691 0.26
692 0.25
693 0.25
694 0.24
695 0.25
696 0.21
697 0.17
698 0.13
699 0.1
700 0.11
701 0.1
702 0.1
703 0.08
704 0.09
705 0.09
706 0.09
707 0.09
708 0.07
709 0.08
710 0.07
711 0.09
712 0.08
713 0.1
714 0.12
715 0.12
716 0.13
717 0.14
718 0.2
719 0.24
720 0.25
721 0.24
722 0.27
723 0.34
724 0.4
725 0.43
726 0.43
727 0.41
728 0.46
729 0.51
730 0.5
731 0.45
732 0.46
733 0.5
734 0.51
735 0.5
736 0.45
737 0.41
738 0.42
739 0.43
740 0.42
741 0.35
742 0.35
743 0.4
744 0.44
745 0.45
746 0.47
747 0.46
748 0.4
749 0.39
750 0.36
751 0.34
752 0.36
753 0.41
754 0.41
755 0.43
756 0.45
757 0.48
758 0.47
759 0.45
760 0.4
761 0.33
762 0.28
763 0.24
764 0.21
765 0.19
766 0.18
767 0.14
768 0.11
769 0.12
770 0.14
771 0.17
772 0.18
773 0.21
774 0.25
775 0.3
776 0.33
777 0.35
778 0.38
779 0.36
780 0.34
781 0.3
782 0.26
783 0.2
784 0.21
785 0.18
786 0.13
787 0.13
788 0.13
789 0.13
790 0.12
791 0.13
792 0.11
793 0.09
794 0.09
795 0.08
796 0.08
797 0.09
798 0.09
799 0.08
800 0.08
801 0.07
802 0.07
803 0.07
804 0.08
805 0.07
806 0.07
807 0.08
808 0.16
809 0.22
810 0.25
811 0.28
812 0.33
813 0.36
814 0.39
815 0.45
816 0.42
817 0.45
818 0.48
819 0.51
820 0.53
821 0.54
822 0.52
823 0.47
824 0.42
825 0.35
826 0.3
827 0.24
828 0.17
829 0.14
830 0.12
831 0.12
832 0.13
833 0.12
834 0.12
835 0.16
836 0.21
837 0.22
838 0.22
839 0.21
840 0.22
841 0.25
842 0.26
843 0.25
844 0.21
845 0.21
846 0.21
847 0.21
848 0.2
849 0.2
850 0.19
851 0.17
852 0.17
853 0.18
854 0.18
855 0.22
856 0.23
857 0.28
858 0.3
859 0.34
860 0.37
861 0.37
862 0.42
863 0.44
864 0.45
865 0.41
866 0.38